-
Články
Top novinky
Reklama- Vzdělávání
- Časopisy
Top články
- Témata
Top novinky
Reklama- Kongresy
- Videa
- Podcasty
Nové podcasty
Reklama- Volná místa
Doporučené pozice
Reklama- Praxe
Top novinky
ReklamaDNA vaccine based on conserved HA-peptides induces strong immune response and rapidly clears influenza virus infection from vaccinated pigs
Authors: Marta Sisteré-Oró aff001; Sergi López-Serrano aff001; Veljko Veljkovic aff002; Sonia Pina-Pedrero aff001; Júlia Vergara-Alert aff001; Lorena Córdoba aff001; Mónica Pérez-Maillo aff001; Patrícia Pleguezuelos aff001; Enric Vidal aff001; Joaquim Segalés aff003; Jens Nielsen aff005; Anders Fomsgaard aff005; Ayub Darji aff001
Authors place of work: IRTA, Centre de Recerca en Sanitat Animal (CReSA, IRTA-UAB), Campus de la Universitat Autònoma de Barcelona, Bellaterra, Barcelona, Spain aff001; Biomed Protection, Galveston, Texas, United States of America aff002; UAB, Centre de Recerca en Sanitat Animal (CReSA, IRTA-UAB), Campus de la Universitat Autònoma de Barcelona, Bellaterra, Barcelona, Spain aff003; Departament de Sanitat i Anatomia Animals, Facultat de Veterinària, UAB, Bellaterra (Cerdanyola del Vallès), Barcelona, Spain aff004; Virus Research and Development Laboratory, Department of Virus and Microbiological Special Diagnostics, Statens Serum Institut, Artillerivej, Copenhagen S, Denmark aff005
Published in the journal: PLoS ONE 14(9)
Category: Research Article
doi: https://doi.org/10.1371/journal.pone.0222201Summary
Swine influenza virus (SIVs) infections cause a significant economic impact to the pork industry. Moreover, pigs may act as mixing vessel favoring genome reassortment of diverse influenza viruses. Such an example is the pandemic H1N1 (pH1N1) virus that appeared in 2009, harboring a combination of gene segments from avian, pig and human lineages, which rapidly reached pandemic proportions. In order to confront and prevent these possible emergences as well as antigenic drift phenomena, vaccination remains of vital importance. The present work aimed to evaluate a new DNA influenza vaccine based on distinct conserved HA-peptides fused with flagellin and applied together with Diluvac Forte as adjuvant using a needle-free device (IntraDermal Application of Liquids, IDAL®). Two experimental pig studies were performed to test DNA-vaccine efficacy against SIVs in pigs. In the first experiment, SIV-seronegative pigs were vaccinated with VC4-flagellin DNA and intranasally challenged with a pH1N1. In the second study, VC4-flagellin DNA vaccine was employed in SIV-seropositive animals and challenged intranasally with an H3N2 SIV-isolate. Both experiments demonstrated a reduction in the viral shedding after challenge, suggesting vaccine efficacy against both the H1 and H3 influenza virus subtypes. In addition, the results proved that maternally derived antibodies (MDA) did not constitute an obstacle to the vaccine approach used. Moreover, elevated titers in antibodies both against H1 and H3 proteins in serum and in bronchoalveolar lavage fluids (BALFs) was detected in the vaccinated animals along with a markedly increased mucosal IgA response. Additionally, vaccinated animals developed stronger neutralizing antibodies in BALFs and higher inhibiting hemagglutination titers in sera against both the pH1N1 and H3N2 influenza viruses compared to unvaccinated, challenged-pigs. It is proposed that the described DNA-vaccine formulation could potentially be used as a multivalent vaccine against SIV infections.
Keywords:
Vaccination and immunization – Vaccines – Antibodies – Influenza viruses – Enzyme-linked immunoassays – Fevers – Swine – Flagellin
Introduction
Swine influenza viruses (SIVs) are single-stranded, negative sense segmented RNA viruses that belong to the Influenzavirus A genus within the Orthomyxoviridae family. SIVs are common throughout pig populations worldwide and they generally cause coughing, sneezing, nasal discharges, fever, conjunctivitis, respiratory difficulties, lethargy, decreased food intake [1–4] and, in some instances, abortions in pregnant sows due to fever [5,6].
Even though pigs recover rapidly from clinical signs caused by SIVs, influenza has been recognized as an important cause of economic loss for the pig industry. The economic consequences are attributed to morbidity rates up to 100% [1] linked to the retarded animal growth and a prolonged finishing period [7]. Besides economic impact, the rapid genetic evolution of these viruses makes their control even more mandatory. On one hand, the antigenic drift phenomena allow the acquisition of point mutations in the hemagglutinin (HA) gene and, to a lesser extent, in the neuraminidase (NA) gene. These mutations may generate mutants able to escape the vaccine-induced immunity [5,8,9]. On the other hand, pigs are considered as “mixing vessels” due to the presence and distribution of both α2,3 - and α2,6 - sialic acid receptors in their respiratory tract [10,11], which might lead to the emergence of new assortment of viruses, like the influenza virus A H1N1 (pH1N1) that emerged in 2009 [12–14].
Vaccination is the most effective approach employed to control SIV infections. Currently, SIV vaccines available on the market are represented by conventional inactivated-type vaccines encompassing strains of H1N1, H1N2 and/or H3N2 subtypes, the most prevalent subtypes in swine herds [15–18]. In spite of the reduction in clinical signs and high antibody titers induced both in serum and alveolus, commercial vaccines have some weaknesses [19,20]. Apart from not being sufficiently protective when the strain does not closely match with the ones included in the vaccine product, they do not confer protection when facing against heterovariant or heterosubtypic challenges [21–24]. Some research studies have hypothesized that this matter could be related to the lack of cell-mediated and/or mucosal responses provided by the inactivated-type vaccines [23,25,26]. Moreover, it is also evidenced that maternally derived antibodies (MDA) may interfere in the development of immunity provided by vaccination [27,28]. Fundamentally, piglets with MDA at vaccination showed prolonged flu-like clinical signs, more severe SIV-pneumonia and suppression of both humoral and cellular responses in comparison to vaccinated MDA-seronegative piglets [27].
For these reasons, many efforts have been directed to design a universal vaccine that should cover all relevant subtypes of influenza, including varying field strains, and able to avoid the likelihood of emergence of forthcoming pandemic strains. The ideal vaccine should also overcome MDA interference. Currently, conserved areas of the virus proteins are targeted for the design of such vaccine [29–33]. In fact, those designs are based on combining different well-conserved epitopes to improve their protection and strain coverage.
Our group has defined new vaccine strategies utilizing conserved epitopes of the influenza A virus (IAV), specifically from the HA protein [29]. In the present work, with the aim to improve our vaccine prototype, a DNA vaccine encoding a combination of HA-conserved immunogenic epitopes along with flagellin (VC4-flagellin) was designed. Selection of these HA peptide epitopes (from H7, H5N1 or pH1N1) was based on the encoded informational spectrum frequencies that are common for the IVs judged by informational spectrum methodology (ISM). Previously, it has been shown that antigens which share a common frequency component in their informational spectra are immunologically cross-reactive [34].
Instead of immunizing animals with this new construct via intramuscular, a needle-free approach (IntraDermal Application of Liquids, IDAL®) was used. This administration route is safer because of the needle-free system and easy to be used in large-scale vaccination programs [35,36]. Moreover, to test the broad-based immunity and the protective efficacy of the vaccine, both MDA-seropositive and MDA-seronegative animals were used and were challenged with either pH1N1 or SwH3N2 to assess the cross-protective effect of the vaccine in two different experiments.
Experiment I was developed under a more favorable scenario: SIV-seronegative pigs challenged with a homologous virus (pH1N1) for the HA-peptide: SLPFQNIHPITIGKCPKYVKSTKLRLATGLRNV. By contrast, experiment II was designed to evaluate vaccine efficacy when the MDA were present and a heterologous virus was challenged (SwH3N2), representing a more unfavorable scenario. Subtypes H1 and H3 were inoculated since they are most common subtypes circulating in swine herds.
Herewith, we demonstrated that vaccination with VC4-flagellin DNA induced high titers of seroprotective/neutralizing antibodies and contributed in reducing the viral shedding of the vaccinated pigs in presence and absence of MDA.
Materials and methods
Immunogen and expression vector construction
Four conserved HA-peptides were predicted in silico by the Informational Spectrum Methodology (ISM) [37,38] and expressed along with a flagellin-derived construct, which was also designed by the ISM bioinformatics platform [39]. The predicted peptides along with the flagellin were organized in tandem to construct the multipeptide: PQRERRRKKRGLFGAIAGVEVVNATETVERTNIPRICSKGKRTVDLGQCGLLTIQVGANDGETIDIDLKQINSQTLSSSGSSGSSGSSIDAALAQVDALRSDLGAVQNRFNSAGVEVVNATETVERTNIPRICSKGKRTVDLGQCGLSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNV, designated hereafter as VC-4-flagellin. This sequence was reverse-translated with codon optimization for swine expression and cloned into the pCDNA3.1(+) plasmid (GenScript, NJ, USA). Table 1 describes each of the four predicted HA epitopes. Expression of the construct was controlled by in vitro transfection and purification of the plasmid at large-scale production was performed with the EndoFree plasmid Gigakit (Qiagen, Barcelona, Spain). Purified plasmid DNA was quantified by using Biodrop μLITE Spectrophotometer (BioDrop Ltd, Cambridge, UK), resuspended in sterile saline solution and kept at -20°C until used.
Tab. 1. Amino acid sequences from the HA-epitopes used in the VC4-flagellin construct; aa positions from their respective consensus IV are also indicated. Cells and antigens
Madin-Darby Canine Kidney (MDCK, ATCC CCL-34) cells were used to prepare viral stocks and to perform the seroneutralization assays on BALFs. MDCKs were grown in Dulbecco’s Modified Eagle Medium (DMEM) supplemented with 10% foetal bovine serum (FBS), 1% penicillin/streptomycin and 1% L-glutamine.
Hemagglutinins of A/California/04/09(H1N1)pdm09 and A/Aichi/2/1968 (H3N2) were acquired from SinoBiological (Cat no. 40340-V08B and 11707-V08H; respectively, SinoBiological Inc., PA, USA) and were used as purified antigens for in-house enzyme-linked immunosorbent assay (ELISA) test developments.
Ethics statement
Experiments with SIVs were performed at the Biosafety Level 3 (BSL-3) facilities at IRTA-CReSA (Barcelona, Spain). The experiment protocols were supervised and approved by the Ethical and Animal Welfare Committee of Institut de Recerca i Tecnologia Agroalimentàries (IRTA) and the Ethical Commission of Animal Experimentation of the Autonomous Government of Catalonia. In addition, both conducted research studies followed the Directive UE 63/2010, the Spanish Legislation, RD 53/2013, the Catalan Law 5/1995, Decree 214/1997 and the ARRIVE guidelines checklist (S1 Checklist).
Animals from Experiment II were housed in a conventional farm during the immunization, and transferred to BSL-3 facilities one week prior to challenge (adaptation period).
In both of the experiments, animals were fed with food and water ad libitum and were not treated with anesthetics or analgesics since they were not suffering from the disease and/or experimental manipulation.
Animal experimental design
Two experiments were carried out to assess the DNA-vaccine efficacy in vivo (Table 2). Clinically healthy pigs purchased from commercial farms were selected and tested for presence of specific antibodies in sera against the influenza nucleoprotein (NP) using the ID Screen ® Influenza A Antibody Competition ELISA (ID VET, France) kit. SIV-seronegative animals were selected for Experiment I. For MDA positive pig studies, piglets were obtained from vaccinated sows and were controlled for having NP antibodies by ELISA. All pigs had antibody titers against H1 and H3 subtypes with an average OD 450 nm of 0.6–0.8 without bias towards maternal antibody titers. Moreover, in both cases, RT-qPCR (see section 2.8.) was also determined to ensure animals were not exposed to IV.
Tab. 2. Schematic outline of Experiments I and II. Experiment I (SIV-seronegative pigs/challenged with pH1N1)
Ten 5-to-6-week-old male pigs seronegative against SIV were randomly divided into two groups: animals 1–5 (Group A, n = 5) and animals 6–10 (Group B, n = 5) and were housed together in the same box. Animals from group B were immunized twice with a 21-day interval period. The immunizations consisted of 600 μg (3 IDAL® shots/200 μg/100 μL animal) of the VC4-flagellin DNA construct mixed in a ratio of 1 : 1 (v/v) with Diluvac Forte® adjuvant (MSD Animal Health, Salamanca, Spain) applied with the IDAL® device (MSD Animal Health) on the dorsal side of the back of each pig [36]. Animals from A group were sham-vaccinated by administration of 2 mL/animal of PBS+DiluvacForte®. Two weeks after booster immunization, all pigs were intranasally challenged with pH1N1. All animals were euthanized seven days post-inoculation (dpi) with an overdose of pentobarbital followed by exsanguination.
Experiment II (SIV-seropositive pigs/challenged with SwH3N2)
Twelve 4-week-old SIV-seropositive male or female pigs were separated into two groups: animals 1–6 (Group A, n = 6) and animals 7–12 (Group B, n = 6). Animals from groups A (sham-vaccinated) and B (VC4-flagellin DNA-vaccinated) were immunized as described in Experiment I. Two weeks after the second immunization, animals were intranasally challenged with SwH3N2. Upon transferred to BSL3 installations, both groups were accommodated together. Animals were euthanized with an overdose of pentobarbital followed by exsanguination either at 7 or 14 dpi.
Sampling and clinical records
Flu-like clinical signs were monitored during all the experiment. Fever was considered when rectal temperatures reached values above 40°C [40]. The sampling schedule for both experiments is represented in Table 3. Briefly, nasal swabs were collected to determine the presence of viral RNA and sera were collected to analyse the humoral immune response at different time-points.
Tab. 3. Sampling schedule for experiments I and II. Complete necropsies were performed at the indicated times after infection (7dpi, Experiment I; 7 or 14 dpi, Experiment II). Gross pictures were taken from both sides of the lung to assess the macroscopiclung lesion score. Subsequently, three lung samples were collected (apical, middle and diaphragmatic lobes) from the left lung and fixed by immersion in 10% neutral buffered formalin to perform histopathological analysis. BALFs were also collected immediately from the right lung after post-mortem examination [41]. The BALF supernatants obtained were stored at -80°C to investigate antibody response (IgG and IgA) and to assess seroneutralizing titres against the challenged virus.
Pathological procedures
Only in experiment II, the macroscopically affected lung area (%) from each individual was quantified by image analysis (IA) (ImageJ ® online free software) as previously described [42]. Formalin fixed tissues from the animals of both of the experiments were dehydrated and embedded in paraffin wax, sectioned at 3–5 μm and stained with hematoxylin-eosin (HE) for examination under light microscopy. In all lung samples, a semi-quantitative scoring method was determined as previously described [43].
SIVs and inoculum preparation
The viruses used for inoculation were the pH1N1 virus (A/Catalonia/63/2009 H1N1 IV) [GenBank GQ464405-GQ464411 and GQ168897] and the SwH3N2 (A/swine/Spain/003/2010 H3N2 IV) [GenBank JQ319724 and JQ319726]. The infectious virus titres were determined by following the Reed and Muench methodology [44]. All pigs were intranasally inoculated with a total dose of 106TCID50/mL (diluted in 3 mL saline solution and delivering a final volume of 1.5 mL/nostril using a mucosal atomisation device (MAD® Nasal; Teleflex ® Inc. NC, USA) to mimic aerogenous infection.
Quantitative real-time RT-PCR (RT-qPCR)
Viral RNA quantification was performed in nasal swab samples using the NucleoSpin RNA isolation kit (MACHEREY-NAGELGmbH&CoKG, Düren, Germany) following the manufacturer’s instructions. Subsequently, a TaqMan RT-qPCR designed to detect influenza viruses (IVs) using the PCR primers and hydrolysis probe already described [45] was run in a Fast7500 equipment (Applied Biosystems, CA, USA) with the conditions already set and described [14].
IgGs and IgAs enzyme-linked immunosorbent assays (ELISAs)
To assess IgG antibody responses against the purified antigens from H1N1 and H3N2 in sera and BALFs samples, specific ELISA tests were developed. Briefly, 96 well plates were coated with 2 μg/mL of each HA antigen diluted in 50 mM sodium bicarbonate buffer and incubated overnight at 4°C. After blocking with 3%BSA/PBS (100μL/well) for 1 hour at room temperature (RT) either serum from individuals diluted at 1 : 100 or neat BALFs samples were added (50μl/well) to the coated plate, followed by 1 hour incubation at RT. Plates were washed three times with 1% Triton X-100/PBS, and anti-pig IgG (whole molecule)-Peroxidase (Sigma-Aldrich, MO, USA) diluted 1 : 10,000 was added to wells followed by 30 minutes incubation at 37°C. After washing the plates four times (1% Triton X-100/PBS), 50 μL of 3, 3’, 5, 5’-tetramethylbenzidine (TMB) substrate solution was added to the wells and allowed to develop protected from light exposure for 10 minutes. Reaction was stopped by adding 50 μL of 1 NH2SO4 and the optical density (OD) was measured at 450 nm. Each sample was run in triplicates.
An in-house ELISA to detect mucosal response (IgA) against hemagglutinins from H1 and H3 subtypes was run in BALF samples. For that purpose, a previous protocol was followed with few modifications and by means of using IgA antibody (Cat no. AA140p; AbDSerotec, Oxford, UK) [46]. Briefly, the high-binding 96-well plates (Costar, Corning Incorpororated, NY, USA) were coated with 2 μg/mL of each HA in 50 mM sodium bicarbonate buffer and incubated overnight at 4°C. Samples were diluted 1 : 1 with blocking buffer.
Hemagglutination inhibition (HI) assay
HI titers were obtained following the standard protocol instructions out of the World Organization for Animal Health (2012) using chicken red blood cells and 4 hemagglutination units of either pH1N1 IV or SwH3N2 IV. All sera were analyzed in duplicates. Positive and negative reference sera (purchased at the GD Animal Health, Deventer, The Netherlands) were used to validate the technique. “Seroprotective” titer (HI≥40) has been used as a criteria of immunogenicity in a vaccine and standard for licensure [47–50].
Serum neutralization test (SNT)
MDCK cells were seeded into 96 - well tissue culture plates to achieve confluence the following day. After 24 hours, BALFs samples were inactivated at 56°C for 30 minutes and serially diluted two-fold up to 1 : 2,560 dilution using DMEM supplemented with 1% penicillin/streptomycin and 1% L-glutamine. In parallel, to promote a proper cleavage of the hemagglutinin protein, the H3N2 virus was trypsinized using porcine-trypsin (Sigma-Aldrich, MO, USA) for 30 minutes at 37°C. After this step, the virus was added to the diluted BALFs to yield final concentrations of 100 TCID50/well. Serum-virus mixtures were incubated at 37°C temperature for 2 hours and were added to PBS 1X washed MDCK cells. Media controls (no virus) and virus controls (no serum) were included on each plate. Reference positive and negative sera against H3N2 (GD Animal Health, Deventer, The Netherlands) were also incorporated. Each sample dilution was plated in duplicates. After an incubation period of 7 days, the plates were read. SNT titers were calculated as 50% endpoints for the greatest serum dilution giving complete inhibition of the virus growth [44].
Flow cytometry
In order to identify the phenotype of T cells, peripheral blood mononuclear cells (PBMCs) were isolated before the challenge from whole blood by density centrifugation using Histopaque®-1077 gradient (Sigma-Aldrich, MO, USA) and performed the flow cytometry using monoclonal antibodies (mAbs). Cell numbers were calculated using a dye solution and the cell concentration was adjusted to 106 cells/well, and single - or double-stained with surface antibodies diluted in PBS 1% anti-CD4 (clone 74-12-4, IgG2b) Alexa Fluor® 647-labelled (BD Pharmingen™, CA, USA) and anti-CD8 (clone 76-2-11, IgG2a) fluorescein isothiocyanate (FITC)-labelled (BD Pharmingen™, CA, USA). Cells were acquired by means of FACSCalibur (Becton Dickinson FACSAria I) (Becton Dickinson, CA, USA), and the positive frequencies analyzed by FACSDiva software, version 8.01. Gated images of different cell populations are shown in S1 Fig.
Statistical analyses
Mean and standard deviations of studied parameters were calculated with Excel 2007 (Microsoft Office). All data obtained were first normalized by the Shapiro-Wilk test and the t-test (in case of normally distributed data) or the Wilcoxon test (in case of non-normally distributed data)and were subsequently used to compare A and B groups within each experiment. Statistical analyses were performed using the R statistical software (http://cran.r-project.org/) and the significance was depicted depending on the significance threshold obtained: P<0.05 (*), P<0.01 (**), P<0.001 (***) and P<0.0001 (****).
Results
Experiment I (SIV-seronegative pigs/challenged with pH1N1):
Clinical and pathological evaluation
Previous to the challenge, all animals were clinically healthy. Upon challenge, one animal out of five (pig 1) from the unvaccinated group had fever at 6 dpi and also one animal (pig 8) from the VC4-flagellin vaccinated group had fever but only at 2 dpi. Also, one animal (pig 2) from the unvaccinated group displayed loose feces at 7 dpi. No other clinical signs were recorded.
Challenge with pH1N1 caused subclinical infection in all pigs and minor histopathological changes observed at the necropsy. No differences in the severity of microscopic lung lesions between vaccinated and unvaccinated animals were recorded. Apart from the lung scorings based on broncho-interstitial pneumonia, other pathological findings were documented. Multiple abscesses were visualized in animal 7; animal 8 had fibrous pleuritis and animal 10 showed pulmonary congestion and edema. All three animals belonged to the VC4-flagellin vaccinated group.
Vaccination using VC4-flagellin limited or reduced pH1N1 viral load
A reduced mean of genomic equivalent copies (GEC) per mL was observed at 5 and 7 dpi in the vaccinated group compared to the unvaccinated group. Furthermore, two out of five animals cleared the virus at 5 dpi and a total of three out of five animals at 7 dpi. All pigs from the unvaccinated group showed viral RNA until the end of the experiment (Fig 1A). Moreover, a summarizing table with individual results of viral clearance and clinical symptoms is attached (S1 Table).
Fig. 1. Viral RNA load in nasal swabs by RT-qPCR. (A) Mean of genomic equivalent copies (GEC) per mL obtained from nasal swabs from seronegative pigs (Experiment I) collected at 0, 5 and 7 dpi (B) and from nasal swabs from seropositive animals (Experiment II) collected at 0, 5, 7, 11 and 14 dpi. Group A (unvaccinated animals) is represented by grey bars and Group B (pCDNA3.1(+)-VC-4-flagellin vaccinated group) by black bars. Dpi, days post-inoculation. Dashed lines indicate the detection limit of the assays: 1.24 log10GEC/mL. Error bars indicate the mean ± SEM. Vaccination using VC4-flagellin induced higher IgG titers in sera against both the H1 and H3 subtypes
Pigs immunized with the VC4-flagellin vaccine manifested a boost in IgG antibodies against H1 and H3 subtypes in sera compared to unvaccinated groups, being the peak at 35 post-vaccination days (PVD) (before the challenge) (Fig 2A and 2B). The increased antibody level was significant (P<0.01) for H1 subtype. In comparison to the H3 subtype, the increment in the antibody levels at 35 PVD was also significant, but with a higher p value (p<0.05). This difference could probably be attributed to one particular animal in this group (pig 10: vaccinated challenged with pH1N1) that, unlike the four other animals from the VC4-flagellin group, did not show seroconversion against H3 neither upon vaccination with VC4-flagellin nor after challenge with pH1N1 influenza virus (IV).
Fig. 2. Serum antibody HA-specific IgG titers detected in sera and BALFs samples by ELISA test. Mean of serum IgG antibody levels detected at 0, 20 PVD, 35 PVD, and 7 DPI of Groups A and B (A) against HA from A/California/04/09(H1N1)pdm09, and (B) against HA from A/Aichi/2/1968(H3N2) are represented. Mean of BALFs IgG antibody levels detected in pigs sacrificed at 7 and 14 dpi of Groups A and B (C) against HA from A/California/04/09(H1N1)pdm09, and (D) against HA from A/Aichi/2/1968(H3N2). Grey circles/bars refer to group A (unvaccinated group), and black squares/bars refer to group B (pCDNA3.1(+)-VC4-flagellin vaccinated group). OD, optical density. PVD, post-vaccination days and DPI, days post-inoculation. Error bars indicate the mean ± SEM. Statistically significant differences between vaccine treatment groups (P value <0.05) are marked with *: P<0.05, **: P<0.01. Vaccination using VC-4 flagellin promoted higher HI titers in sera against pH1N1
Likewise, to discriminate whether the antibodies obtained in sera could also block viral entry, we carried out an HI assay against the pH1N1. Two of the five VC4-flagellin vaccinated pigs showed values≥40 before challenge (35 PVD) and, unexpectedly, one pig from the unvaccinated group (Fig 3A). Nevertheless, the differences among groups were more illustrative at 7 dpi, when all pigs from the VC4-flagellin vaccinated displayed HI titers≥40. In contrast, only two unvaccinated pigs (animal 11 and 12) obtained seroprotective titers (animal 1, 1 : 40; animal 12; 1 : 160) at 7 dpi (Fig 3A).
Fig. 3. HI activity against pH1N1 from seronegative pigs (Experiment I) and against H3N2 from seropositive pigs (Experiment II). HI titers obtained with sera from unvaccinated (Group A) and vaccinated (Group B) pigs against (A) the pH1N1 from SIV-seronegative pigs (Experiment I) and (B) the SwH3N2 from SIV-seropositive pigs (Experiment II). Grey circles refer to group A (unvaccinated group) and black squares depict group B (pCDNA3.1(+)-VC-4-flagellin vaccinated group). HI, hemagglutination inhibition. DPI, days post-inoculation. Dashed lines indicate the threshold to obtain a “seroprotective” titer (HI≥40) which has been used as a criterion of immunogenicity in a vaccine. Error bars indicate the mean ± SEM and statistically significant differences between vaccine treatment groups are marked with **: P<0.01. Experiment II (SIV-seropositive pigs/challenged with SwH3N2)
Clinical and pathological evaluation
Clinical examination revealed that four animals of each group (unvaccinated and VC4-flagellin vaccinated) exhibited fever. These animals corresponded to pig number 1 (fever at 6 and 7 dpi), 2(fever at the challenge day), 5 (fever at 3, 4 dpi) and 6 (fever from 3 to 7 dpi) from the unvaccinated group. From the VC4-flagellin group, the pigs with fever were the number 7 (fever at 4 dpi), 10 (fever at 3 and 7 dpi), 11 (fever at 2, 5 and 7 dpi) and 12 (fever from 2 to 4 dpi). Referring to clinical signs, one unvaccinated pig (pig 1) was coughing at 3 dpi. Three pigs vaccinated with VC4-flagellin were also coughing: pig number 7 and 8 (both coughing at 3 dpi) and pig 11 (at 4 dpi).
Using ImageJ ® analysis tools, the percentage of affected lung area of pigs were examined. Results revealed that two out of the three unvaccinated pigs (pig 1 and 5) had multifocal pulmonary cranio-ventral consolidation lesions: 4.11% and 2.93%, respectively, observed on the dorsal side of the lung. From the VC4-flagellin vaccinated group only one pig (pig 9) had dorsally (3.04%) and ventrally (2.61%) visible macroscopic lesions. Lungs collected at 14 dpi did not have lesions.
Intranasal inoculation with SwH3N2 caused a mild infection in all pigs and minor histopathological changes observable at necropsy. No differences in the severity of microscopic lung lesions of vaccinated and unvaccinated animals were recorded. Representatively, observations detected at 7 and 14 dpi from the second experiment are depicted in Table 4. Other pathological findings documented were one unvaccinated pig (animal 1) and two vaccinated pigs (animal 7 and 9) with suppurative bronchopneumonia. In addition, one immunized pig (animal 8) had fibrous pleuritis.
Tab. 4. Pathological microscopic score for all the animals from Experiment II based on BIP-compatible lesions. BIP was assessed by a semi-quantitative scoring (0–3, indicating lack of, mild, moderate or severe pneumonia lesions, respectively). Vaccination using VC4-flagellin limited or reduced SwH3N2 viral load
The mean of GEC from the VC4-flagellin vaccinated group was lower than the unvaccinated group at 5 and 7 dpi. Notably, four out of six VC4-flagellin vaccinated pigs cleared the virus at 7 dpi. Conversely, none of the unvaccinated group was able to clear the virus at 7 dpi (P<0.01) (Fig 1B).The unvaccinated-infected pigs continued shedding influenza virus up to 14 dpi (Fig 1B) whereas IV virus was not detected in VC4-flagellin vaccinated group (Fig 1B). Additionally, a summarizing table with individual results of viral clearance and clinical symptoms is attached (S2 Table).
Vaccination using VC4-flagellin induced superior IgG titers in BALFs against both the H1 and H3 subtypes
The presence of specific antibodies against H1 and H3 was also examined in the BALF samples from seropositive animals. The average of IgG antibody values at 7 and 14 dpi of the H1 and H3 subtypes were higher in the vaccinated group (Fig 2C and 2D). Considering that the challenged virus in Experiment II was from H3 subtype, enhanced antibody values were expected against H3 (Fig 2D).
Vaccination using VC4-flagellin promoted higher HI titers in sera against SwH3N2
No evident seroconversion effect in the seropositive pigs against H1 and H3 subtypes could be observed. However, animals did show HI activities in sera after challenge. HI results against the SwH3N2 evidenced that the VC4-flagellin vaccinated pigs had higher HI titers at 7 and 14 dpi than the unvaccinated animals. At 7 dpi, all pigs from the VC4-flagellin vaccinated group exhibited a positive HI titer (≥40) (P<0.01). Contrarily, only three out of six animals of the unvaccinated group remained with seroprotective titers ≥40. In addition, at 14 dpi, the inhibiting capacity of the three remaining VC4-flagellin vaccinated animals (animal 7; 1 : 640; animal 11; 1 : 320, animal 12; 1 : 640) was higher than the remaining three unvaccinated (animal 3; 1 : 40, animal 4; 1 : 320; animal 5; 1 : 160) (Fig 3B).
Vaccination using VC4-flagellin induced stronger IgA responses in BALF samples
The mucosal antibody response was investigated in the BALF samples. Against H1 subtype, vaccinated pigs elicited an increase in the IgA response in comparison to unvaccinated pigs at 7 dpi (Fig 4A). At 14 dpi, the same tendency was observed although the OD values of antibodies were less than at 7 dpi. At 7 and 14 dpi, the VC4-flagellin vaccinated pigs exhibited elevated IgA values compared to the unvaccinated pigs when analyzing IgAs against H3 subtype (Fig 4B).
Fig. 4. Antibody HA-specific IgA titers detected in BALFs samples from Experiment II. Mean of BALFs IgA antibody levels detected in pigs sacrificed at 7 and 14 dpi of Groups A and B (A) against HA from A/California/04/09(H1N1)pdm09, and (B) against HA from A/Aichi/2/1968(H3N2). Grey bars refer to group A (unvaccinated group), and black bars refer to group B (pCDNA3.1(+)-VC4-flagellin vaccinated group). OD, optical density. PVD, post-vaccination days and DPI, days post-inoculation. Error bars indicate the mean ± SEM. Vaccination using VC4-flagellin promoted higher SNT titers in BALFs
After determining that the VC4-flagellin vaccinated group displayed higher antibody titers in the BALFs compared to the unvaccinated pigs, we were intrigued to find whether the elicited antibodies could neutralize the virus. VC4-flagellin vaccinated pigs showed higher mean values of seroneutralizing antibody titres in BALFs than the unvaccinated pigs at 7 and 14 dpi (Fig 5). Moreover, at 7 dpi, all animals from the vaccinated group manifested seroneutralizing titres (animal 6, value 1 : 20; animal 8, value 1 : 20; animal 9; 1 : 60). None of the unvaccinated animals developed seroneutralizing antibodies. At 14 dpi, two out of three unvaccinated pigs achieved seroneutralizing titres (animal 3, 1 : 60; animal 4, 1 : 320), but to lesser extent than immunized pigs (animal 8, value 1 : 320; animal 11, value 1 : 1280, animal 12, value 1 : 120).
Fig. 5. Seroneutralization (SN) titers detected in BALF samples from Experiment II by seroneutralization assay. Mean of seroneutralization titers detected at 7 and 14 dpi of Groups A and B against the A/swine/Spain/003/2010 H3N2 IV challenged virus. Grey bars refer to group A (unvaccinated group) and black bars depict group B (pCDNA3.1(+)-VC-4-flagellin vaccinated group). SN, seroneutralization. DPI, days post-inoculation. Error bars indicate the mean ± SEM. Vaccination using VC4-flagellin promoted higher percentage of double-positive T-cells CD4-CD8
A numeric increment of phenotypic population of T-cells CD4 SP (single positive) and T-cells CD8 SP was observed in the vaccinated group in comparison to the unvaccinated group prior to challenge; such increase was significant for CD4-CD8 DP (double positive) cells (P<0.001) (Fig 6).
Fig. 6. Flow cytometry from PBMCs isolated at 35 PVD (Experiment II). Mean of the percentages of T cells CD4, CD8 and CD4-CD8 DP from unvaccinated (Group A) and vaccinated (Group B). Grey bars refer to group A (unvaccinated group) and black bars depict group B (pCDNA3.1(+)-VC-4-flagellin vaccinated group). Error bars indicate the mean ± SEM and statistically significant differences between vaccine treatment groups are marked with ***: P<0.001. Discussion
Each year there is the demand to identify the strains of influenza A and B viruses that will be circulating in the next season, in order to manufacture the best option for seasonal influenza vaccines. Consequently, universal vaccines against influenza virus making use of highly conserved epitopes or proteins have been investigated during recent years. The present study describes how the combination of several conserved HA-peptides in a DNA approach constitutes a potential influenza vaccine for use in conventional pigs.
All HA-peptides included in the DNA approach presented were selected by means of the ISM platform, which is based on virtual spectroscopy [37,38]. HA-peptides were selected since well-matched antibodies to the HA can block an influenza virus infection and also contribute to the clearance of the virus from the lungs [51,52]. Furthermore, to obtain an improved presentation of the antigens and to enhance immunogenicity, flagellin was fused to the conserved HA-peptides. Such approach should result more potent and efficacious since incorporates TLR-ligands (such as flagellin) [53]. The flagellin ligand fused to an antigen of interest has been shown to yield vaccines able to induce higher IgG responses by means of improving antigen presenting cells (APCs) functions [53–57]. Moreover, flagellin induces TLR5 signaling and this pathway triggers the recruitment of granulocytes and macrophages/monocytes in the respiratory airways. Subsequently, the production of cytokines and chemokines required to initiate strong humoral and cellular responses is primed [39]. This characteristic is coherently related to the flagellin stimulation of monocytes to produce IL-10 and TNFα cytokines [58], of the NK cells to deliver IFNγ and α-defensins and of the T cells to proliferate and produce cytokines and chemokines (e.g. IL-10, IL-8 and IFNγ) [59]. Furthermore, it is a usual practice to include flagellin (FliC) as an adjuvant in novel universal vaccine approaches to face influenza viruses [53,60–64]. It is reported in those studies that conserved influenza epitopes linked to the flagellin either at the N or C terminus, or inclusive in its hypervariable region, did not impair the proper binding of the flagellin ligand to the TLR5.
Due to the final length of the construct and since DNA vaccines can provide the activation of both humoral and cellular responses, the construct VC4-flagellin was reverse-translated into a pCDNA3.1(+) plasmid. Moreover, DNA-based vaccines may cross-protect when facing heterologous swine influenza viruses without being as hazardous as the attenuated-typed [65]. Besides, a suitable delivery platform of the vaccine was sought. At the very end, an intradermal delivery approach seems to promote higher antibody titers than the intramusucular route [66–68]. The overall approach used was also selected because the optimal doses of DNA plasmid (moles) to be used were already described [69].
Thus, in this work, the VC-4-flagellin construct administered intradermally mixed with Diluvac Forte® adjuvant was tested as a vaccine candidate in pigs with or without MDA. Diluvac Forte® was mixed with the vaccine formulation but also was administered to unvaccinated pigs. Intriguingly, the VC4-flagellin vaccinated pigs demonstrated a reduction/clearance of the viral shedding in days 5 and 7 in Experiment I (seronegative animals, pH1N1 challenged) (Fig 1A) and in Experiment II (seropositive animals, H3N2 challenged) (Fig 1B). Therefore, we anticipate that MDA antibodies were not an apparent obstacle for the vaccine to reduce viral shedding and, eventually, to potentially block the viral transmission. Surprisingly, unlike unvaccinated pigs, seropositive vaccinated pigs did not shed the challenge H3N2 virus at 11 or 14 dpi although they were constantly in contact with unvaccinated infected animals (Fig 1B). This fact indicated that vaccination with VC4-flagellin not only limited the virus shedding from vaccinated pigs but, most possibly, also prevented re-infection in a contaminated environment. Further studies are needed to prove this assumption using contact infection experiments in larger groups.
Previous to challenge, the vaccinated animals of Experiment I could recognize both the H1 and H3 IV-subtypes (Fig 2A and 2B). In consequence, seroconversion and a cross-protecting effect against the two IV-subtypes were demonstrated. Apart from the post-vaccination seroconversion, the HI titers of ≥40 are considered to constitute a marker that correlates in vitro with protection [47–50]. Analyzing HI titers against pH1N1 (Experiment I, SIV-seronegative pigs/challenged with pH1N1) seroprotective antibodies could be found in 2 out of 5 pigs prior to the challenge. Noticeably, all the five vaccinated pigs manifested seroprotective titers at 7 dpi (Fig 3A). Moreover, seropositive vaccinated pigs elicited against SwH3N2 higher HI values at 7 and 14 dpi than the unvaccinated group, confirming that MDA were not interfering with the vaccine effect (Fig 3B).
Nevertheless, the vaccine failed to reduce the influenza clinical signs and lung lesions (Table 4). Indeed, no relevant differences were found between groups. Also, it is vital to take into consideration that the clinical picture and disease caused by the pH1N1 in pigs it is generally mild and subclinical [70,71]. In fact, in Experiment I very little number of pigs manifested fever or any clinical sign.
IgG and IgA antibody titers against H1 and H3 subtypes and their seroneutralizing effect against the challenge virus were analyzed in the BALFs of Experiment II. Overall, IgG antibodies were to a higher rate against both the H1 and H3 subtypes in DNA-vaccinated animal group than the unvaccinated group at 7 and 14 dpi (Fig 2C and 2D). The major difference among groups was observed at 14 dpi against the H3 subtype (Fig 2D). Assuming that the challenged virus in Experiment II was an H3N2 virus, elevated H3 antibodies were expected. Furthermore, a stronger seroneutralizing effect could be observed in the BALF samples obtained from the vaccinated pigs than in the samples from the unvaccinated ones (Fig 5). IgA antibodies were also to a higher rate against both the H1 and H3 subtypes in the vaccinated group than the unvaccinated one at 7 days pot-infection (Fig 4). A comparable tendency of IgA antibodies was observed in BALFs collected at 14 dpi against H3 subtype, indicating an enhanced mucosal immune response induced after VC-4-flagellin vaccination in pigs (Fig 4B). This is in line with studies claiming that mucosal immune response is necessary for the design of an universal influenza vaccine as it is the first line of defense against IVs [72,73]. We consider that mucosal immune response (IgA) elicited after VC-4-flagellin vaccination in pigs might have contributed in limiting virus shedding and cross-protection, as reported previously also by others [74,75].
VC-4-flagellin vaccination in pigs, interestingly, also showed an increase in the frequency of the CD4-CD8 DP T cells subset (Fig 6). In fact, results from an earlier report [76] evidenced that some CD4-CD8 DP T cell subset likely belong to effector memory T cells (TEM). This data was only analyzed at pre-challenge time point and not followed after the challenge. Further investigation would be necessary to ultimately define the role of the CD4-CD8 DP T cell subset in protection and clearance of IV after VC-4-flagellin vaccination in pigs.
Our results strongly indicate that HA specific immune response effectively contributed to control influenza infections after VC-4 flagellin vaccination without MDA apparent interference. Promoting a solid systemic mucosal response and blocking viral transmission by reducing earlier the viral shedding were the key outcomes in the VC4-flagellin vaccination approach. Therefore, VC4-flagellin as such maybe an interesting vaccine candidate against H1 and H3 subtypes. However, more studies are crucial in order to vaccinate with VC4-flagellin and mitigate clinical manifestations and lung pathology.
Supporting information
S1 Checklist [pdf]
ARRIVE guidelines checklist fulfilled according to the parameters followed in both of the two swine experimental designs.S1 Fig [tif]
Plots for gating CD4, CD8 SP T-lymphocytes and CD4-CD8 DP lymphocytes in flow cytometry.S1 Table [pdf]
Individual animal GEC per mL of the nasal swabs samples collected from the 1 experiment at 5 and 7 dpi.S2 Table [pdf]
Individual animal GEC per mL of the nasal swabs samples collected from the 2 experiment at 5, 7, 11 and 14 dpi.S3 Table [pdf]
Mean and mean of the standard deviation of the GEC per mL of the nasal swabs samples collected from the 1 experiment at 0, 5 and 7.S4 Table [pdf]
Mean and mean of the standard deviation of the GEC per mL of the nasal swabs samples collected from the 2 experiment at 0, 5, 7, 11 and 14.S5 Table [pdf]
Mean and standard deviations of OD 450 nm IgG values obtained against HA of A/California/04/09(H1N1)pdm09 from sera samples for each triplicate at 0, 20PVD, 35PVD and 7 dpi.S6 Table [pdf]
Mean and standard deviation of OD 450 nm IgG values obtained against HA from A/Aichi/2/1968(H3N2) from sera samples for each triplicate at 0, 20PVD, 35PVD and 7 dpi.S7 Table [pdf]
Mean and standard deviation of OD 450 nm IgG values obtained against HA from A/California/04/09(H1N1)pdm09 from BALFs samples for each triplicate at 7 and 14 dpi.S8 Table [pdf]
Mean and standard deviation of OD 450 nm IgG values obtained against HA from A/Aichi/2/1968(H3N2) from BALFs samples for each triplicate at 7 and 14 dpi.S9 Table [pdf]
Individual animal mean HI titer obtained against virus A/Catalonia/63/2009 H1N1 IV from sera samples for each duplicate at 35 PVD and 7 dpi (1 experiment).S10 Table [pdf]
Individual animal mean HI titer obtained against virus A/swine/Spain/003/2010 H3N2 IV from sera samples for each duplicate at 7 dpi and 14 dpi (2 experiment).S11 Table [pdf]
IgA Mean and standard deviation of OD 450 nm IgA values obtained against HA from A/California/04/09(H1N1)pdm09 from BALF samples for each triplicate at 7 dpi and 14 dpi.S12 Table [pdf]
Mean and standard deviation of OD 450 nm IgA values obtained against HA from A/Aichi/2/1968(H3N2) from BALF samples for each triplicate at 7 and 14 dpi.S13 Table [pdf]
Mean and standard deviation of SNT titers obtained against A/swine/Spain/003/2010 H3N2 IV from sera samples for each duplicate at 7 and 14 dpi.S14 Table [pdf]
Mean and standard deviations of % of CD4, CD8 and CD4-CD8 T cells from PBMCs samples for each duplicate at prechallenge time-point (2 experiment).
Zdroje
1. Kothalawala H, Toussaint MJM, Gruys E. An overview of swine influenza. Vet Q. 2006;28 : 46–53. Available: http://www.ncbi.nlm.nih.gov/pubmed/16841566 16841566
2. Gorres JP, Lager KM, Kong WP, Royals M, Todd JP, Vincent AL, et al. DNA vaccination elicits protective immune responses against pandemic and classic swine influenza viruses in pigs. Clin Vaccine Immunol. American Society for Microbiology (ASM); 2011;18 : 1987–1995. Available: http://www.ncbi.nlm.nih.gov/pubmed/21918118 doi: 10.1128/CVI.05171-11 21918118
3. Martín-Valls GE, Simon-Grifé M, van Boheemen S, de Graaf M, Bestebroer TM, Busquets N, et al. Phylogeny of Spanish swine influenza viruses isolated from respiratory disease outbreaks and evolution of swine influenza virus within an endemically infected farm. Vet Microbiol. Elsevier; 2014;170 : 266–277. Available: https://www-sciencedirect-com.are.uab.cat/science/article/pii/S0378113514001217?via%3Dihub doi: 10.1016/j.vetmic.2014.02.031 24685238
4. Alexander DJ, Brown IH. Recent zoonoses caused by influenza A viruses. Rev Sci Tech. 2000;19 : 197–225. Available: http://www.ncbi.nlm.nih.gov/pubmed/11189716 11189716
5. Rahn J, Hoffmann D, Harder TC, Beer M. Vaccines against influenza A viruses in poultry and swine: Status and future developments. Vaccine. Elsevier Ltd; 2015;33 : 2414–2424. Available: doi: 10.1016/j.vaccine.2015.03.052 25835575
6. World Organisation for Animal Health. Manual of diagnostic tests and vaccines for terrestrial animals [Internet]. 2012. Available: http://www.oie.int/en/standard-setting/terrestrial-manual/access-online/
7. Zimmerman Jeffrey J., Karriker Locke A., Ramirez Alejandro, Schwartz GWS Kent J. Diseases of Swine, 10th Edition. 2012. pp. 557–572.
8. Grund C, Abdelwhab E-SM, Arafa AS, Ziller M, Hassan MK, Aly MM, et al. Highly pathogenic avian influenza virus H5N1 from Egypt escapes vaccine-induced immunity but confers clinical protection against a heterologous clade 2.2.1 Egyptian isolate. Vaccine. Elsevier; 2011;29 : 5567–5573. Available: https://www-sciencedirect-com.are.uab.cat/science/article/pii/S0264410X11000223?via%3Dihub doi: 10.1016/j.vaccine.2011.01.006 21244859
9. Connie Leung YH, Luk G, Sia SF, Wu YO, Ho CK, Chow KC, et al. Experimental challenge of chicken vaccinated with commercially available H5 vaccines reveals loss of protection to some highly pathogenic avian influenza H5N1 strains circulating in Hong Kong/China. Vaccine. Elsevier; 2013;31 : 3536–3542. Available: https://www-sciencedirect-com.are.uab.cat/science/article/pii/S0264410X13006919?via%3Dihub doi: 10.1016/j.vaccine.2013.05.076 23791547
10. Ito T, Couceiro JN, Kelm S, Baum LG, Krauss S, Castrucci MR, et al. Molecular basis for the generation in pigs of influenza A viruses with pandemic potential. J Virol. 1998;72 : 7367–7373. 9696833
11. Castrucci MR, Donatelli I, Sidoli L, Barigazzi G, Kawaoka Y, Webster RG. Genetic reassortment between avian and human influenza A viruses in italian pigs. Virology. Academic Press; 1993;193 : 503–506. Available: https://www-sciencedirect-com.are.uab.cat/science/article/pii/S0042682283711554?via%3Dihub doi: 10.1006/viro.1993.1155 8438586
12. Smith GJ, Vijaykrishna D, Bahl J, Lycett SJ, Worobey M, Pybus OG, et al. Origins and evolutionary genomics of the 2009 swine-origin H1N1 influenza A epidemic. Nature. Nature Publishing Group; 2009;459 : 1122–1125. Available: http://www.nature.com/articles/nature08182 doi: 10.1038/nature08182 19516283
13. Garten RJ, Davis CT, Russell CA, Shu B, Lindstrom S, Balish A, et al. Antigenic and genetic characteristics of swine-origin 2009 A(H1N1) influenza viruses circulating in humans. Science. 2009;325 : 197–201. Available: http://www.ncbi.nlm.nih.gov/pubmed/19465683 doi: 10.1126/science.1176225 19465683
14. Busquets N, Segalés J, Córdoba L, Mussá T, Crisci E, Martín-Valls GE, et al. Experimental infection with H1N1 European swine influenza virus protects pigs from an infection with the 2009 pandemic H1N1 human influenza virus. Vet Res. 2010;41 : 1–14. doi: 10.1051/vetres/2009049
15. Webster RG, Bean WJ, Gorman OT, Chambers TM, Kawaoka Y. Evolution and ecology of influenza A viruses. Microbiol Rev. American Society for Microbiology (ASM); 1992;56 : 152–79. Available: http://www.ncbi.nlm.nih.gov/pubmed/1579108 1579108
16. Landolt GA, Olsen CW. Up to new tricks—a review of cross-species transmission of influenza A viruses. Anim Heal Res Rev. 2007;8 : 1–21. Available: https://www.cambridge.org/core/product/identifier/S1466252307001272/type/journal_article
17. Simon G, Larsen LE, Dürrwald R, Foni E, Harder T, Van Reeth K, et al. European surveillance network for influenza in pigs: Surveillance programs, diagnostic tools and swine influenza virus subtypes identified in 14 European countries from 2010 to 2013. PLoS One. 2014;9 : 1–21.
18. Brown IH. History and epidemiology of swine influenza in Europe. Curr Top Microbiol Immunol. 2011;370 : 133–146. Available: http://www.ncbi.nlm.nih.gov/pubmed/22234411
19. Sandbulte MR, Spickler AR, Zaabel PK, Roth JA. Optimal use of vaccines for control of influenza A virus in swine. Vaccines (Basel). 2015;3 : 22–73. doi: 10.3390/vaccines3010022 26344946
20. Vincent AL, Perez DR, Rajao D, Anderson TK, Abente EJ, Walia RR, et al. Influenza A virus vaccines for swine. Vet Microbiol. 2017;206 : 35–44. Available: http://www.ncbi.nlm.nih.gov/pubmed/27923501 doi: 10.1016/j.vetmic.2016.11.026 27923501
21. Bikour MH, Cornaglia E, Elazhary Y. Evaluation of a protective immunity induced by an inactivated influenza H3N2 vaccine after an intratracheal challenge of pigs. Can J Vet Res. 1996;60 : 312–4. Available: http://www.ncbi.nlm.nih.gov/pubmed/8904668 8904668
22. Dürrwald R, Krumbholz A, Baumgarte S, Schlegel M, Vahlenkamp TW, Selbitz HJ, et al. Swine influenza A vaccines, pandemic (H1N1) 2009 virus, and cross-reactivity. Emerg Infect Dis. 2010;16 : 1029–1030. Available: http://www.ncbi.nlm.nih.gov/pubmed/20507767 doi: 10.3201/eid1606.100138 20507767
23. Ma W, Richt JA. Swine influenza vaccines: current status and future perspectives. Anim Health Res Rev. 2010;11 : 81–96. doi: 10.1017/S146625231000006X 20462470
24. Vincent AL, Ciacci-Zanella JR, Lorusso A, Gauger PC, Zanella EL, Kehrli ME, et al. Efficacy of inactivated swine influenza virus vaccines against the 2009 A/H1N1 influenza virus in pigs. Vaccine. Elsevier Ltd; 2010;28 : 2782–2787. Available: doi: 10.1016/j.vaccine.2010.01.049 20132919
25. Van Reeth K, Gregory V, Hay A, Pensaert M. Protection against a European H1N2 swine influenza virus in pigs previously infected with H1N1 and/or H3N2 subtypes. Vaccine. 2003;21 : 1375–1381. doi: 10.1016/s0264-410x(02)00688-6 12615433
26. Van Reeth K, Brown I, Essen S, Pensaert M. Genetic relationships, serological cross-reaction and cross-protection between H1N2 and other influenza a virus subtypes endemic in European pigs. Virus Res. 2004;103 : 115–124. doi: 10.1016/j.virusres.2004.02.023 15163499
27. Kitikoon P, Nilubol D, Erickson BJ, Janke BH, Hoover TC, Sornsen SA, et al. The immune response and maternal antibody interference to a heterologous H1N1 swine influenza virus infection following vaccination. Vet Immunol Immunopathol. 2006;112 : 117–128. doi: 10.1016/j.vetimm.2006.02.008 16621020
28. Markowska-Daniel I, Pomorska-Mól M, Pejsak Z. The influence of age and maternal antibodies on the postvaccinal response against swine influenza viruses in pigs. Vet Immunol Immunopathol. Elsevier B.V.; 2011;142 : 81–86. Available: doi: 10.1016/j.vetimm.2011.03.019 21501880
29. Vergara-Alert J, Argilaguet JM, Busquets N, Ballester M, Martín-Valls GE, Rivas R, et al. Conserved synthetic peptides from the hemagglutinin of influenza viruses induce broad humoral and T-cell responses in a pig model. PLoS One. 2012;7.
30. Margine I, Krammer F, Hai R, Heaton NS, Tan GS, Andrews SA, et al. Hemagglutinin stalk-based universal vaccine constructs protect against group 2 influenza A viruses. J Virol. 2013;87 : 10435–10446. Available: http://jvi.asm.org/content/87/19/10435%5Cnhttp://jvi.asm.org/content/87/19/10435.abstract?etoc%5Cnhttp://jvi.asm.org/content/87/19/10435.full.pdf%5Cnhttp://www.ncbi.nlm.nih.gov/pubmed/23903831 doi: 10.1128/JVI.01715-13 23903831
31. Wang TT, Tan GS, Hai R, Pica N, Ngai L, Ekiert DC, et al. Vaccination with a synthetic peptide from the influenza virus hemagglutinin provides protection against distinct viral subtypes. Proc Natl Acad Sci U S A. 2010;107 : 18979–18984. doi: 10.1073/pnas.1013387107 20956293
32. Ma JH, Yang FR, Yu H, Zhou YJ, Li GX, Huang M, et al. An M2e-based synthetic peptide vaccine for influenza A virus confers heterosubtypic protection from lethal virus challenge. Virol J. Virology Journal; 2013;10 : 227. Available: http://www.virologyj.com/content/10/1/227 doi: 10.1186/1743-422X-10-227 23834899
33. Krammer F, Pica N, Hai R, Tan GS, Palese P. Hemagglutinin stalk-reactive antibodies are boosted following sequential infection with seasonal and pandemic H1N1 influenza virus in mice. J Virol. American Society for Microbiology (ASM); 2012;86 : 10302–7. Available: http://www.ncbi.nlm.nih.gov/pubmed/22787225 doi: 10.1128/JVI.01336-12 22787225
34. Veljkovic V, Glisic S, Veljkovic N, Bojic T, Dietrich U, Perovic VR, et al. Influenza vaccine as prevention for cardiovascular diseases: possible molecular mechanism. Vaccine. 2014;32 : 6569–75. Available: https://linkinghub.elsevier.com/retrieve/pii/S0264410X14009335 doi: 10.1016/j.vaccine.2014.07.007 25045818
35. Borggren M, Nielsen J, Bragstad K, Karlsson I, Krog JS, Williams JA, et al. Vector optimization and needle-free intradermal application of a broadly protective polyvalent influenza A DNA vaccine for pigs and humans. Hum Vaccines Immunother. 2015;11 : 1983–1990.
36. Karlsson I, Borggren M, Rosenstierne MW, Trebbien R, Williams JA, Vidal E, et al. Protective effect of a polyvalent influenza DNA vaccine in pigs. Vet Immunol Immunopathol. 2018;195 : 25–32. Available: http://linkinghub.elsevier.com/retrieve/pii/S0165242717304099 doi: 10.1016/j.vetimm.2017.11.007 29249314
37. Veljkovic V, Niman HL, Glisic S, Veljkovic N, Perovic V, Muller CP. Identification of hemagglutinin structural domain and polymorphisms which may modulate swine H1N1 interactions with human receptor. BMC Struct Biol. 2009;9 : 62. Available: doi: 10.1186/1472-6807-9-62 19785758
38. Veljkovic V, Veljkovic N, Muller CP, Müller S, Glisic S, Perovic V, et al. Characterization of conserved properties of hemagglutinin of H5N1 and human influenza viruses: possible consequences for therapy and infection control. BMC Struct Biol. 2009;9 : 21. doi: 10.1186/1472-6807-9-21 19351406
39. Colombatti A, Doliana R, Veljkovic V, Veljkovic N, Glisic S, Perovic V. Peptide agonists of toll-like receptor 5 ligand and methods of use [Internet]. WO/2015/166010, 2015. WO/2015/166010
40. Galindo-Cardiel I, Ballester M, Solanes D, Nofrarías M, López-Soria S, Argilaguet JM, et al. Standardization of pathological investigations in the framework of experimental ASFV infections. Virus Res. Elsevier; 2013;173 : 180–190. Available: https://www-sciencedirect-com.are.uab.cat/science/article/pii/S0168170212004996 doi: 10.1016/j.virusres.2012.12.018 23313935
41. Nielsen J, Bøtner A, Tingstedt J, Aasted B, Johnsen C., Riber U, et al. In utero infection with porcine reproductive and respiratory syndrome virus modulates leukocyte subpopulations in peripheral blood and bronchoalveolar fluid of surviving piglets. Vet Immunol Immunopathol. Elsevier; 2003;93 : 135–151. Available: https://www-sciencedirect-com.are.uab.cat/science/article/pii/S0165242703000680?via%3Dihub doi: 10.1016/s0165-2427(03)00068-0 12814699
42. Sibila M, Aragón V, Fraile L, Segalés J. Comparison of four lung scoring systems for the assessment of the pathological outcomes derived from Actinobacillus pleuropneumoniae experimental infections. BMC Vet Res. BioMed Central; 2014;10 : 165. Available: http://www.ncbi.nlm.nih.gov/pubmed/25038822 doi: 10.1186/1746-6148-10-165 25038822
43. Detmer SE, Gunvaldsen RE, Harding JC. Comparison of influenza A virus infection in high - and low-birth-weight pigs using morphometric analysis. Influenza Other Respi Viruses. 2013;7 Suppl 4 : 2–9. Available: http://doi.wiley.com/10.1111/irv.12199
44. Reed LJ, Muench H. A simple method of estimating fifty per cent endpoint. Am J Hyg. 1938;27 : 493–497.
45. Spackman E, Senne DA, Myers TJ, Bulaga LL, Garber LP, Perdue ML, et al. Development of a real-time reverse transcriptase PCR assay for type A influenza virus and the avian H5 and H7 hemagglutinin subtypes. J Clin Microbiol. 2002;40 : 3256–3260. doi: 10.1128/JCM.40.9.3256-3260.2002 12202562
46. Olvera A, Pina S, Pérez-Simó M, Aragón V, Segalés J, Bensaid A. Immunogenicity and protection against Haemophilus parasuis infection after vaccination with recombinant virulence associated trimeric autotransporters (VtaA). Vaccine. Elsevier; 2011;29 : 2797–2802. Available: https://www-sciencedirect-com.are.uab.cat/science/article/pii/S0264410X11001770?via%3Dihub doi: 10.1016/j.vaccine.2011.01.105 21320547
47. Wijnans L, Voordouw B. A review of the changes to the licensing of influenza vaccines in Europe. Influenza Other Respi Viruses. Wiley-Blackwell; 2016;10 : 2–8. Available: http://www.ncbi.nlm.nih.gov/pubmed/26439108
48. Wood JM, Levandowski RA. The influenza vaccine licensing process. Vaccine. Elsevier; 2003;21 : 1786–1788. Available: https://www.sciencedirect.com/science/article/pii/S0264410X03000732?via%3Dihub doi: 10.1016/s0264-410x(03)00073-2 12686095
49. The European agency for the evaluation of medical products. Note for guidence on harmonisation of requirements for influenza vaccines [Internet]. 1997 p. 19. Available: https://www.ema.europa.eu/en/harmonisation-requirements-influenza-vaccines
50. Department of health and human services. Food and drug administration. Center for biologics evaluation and research. Guidance for industry: Clinical data needed to support the licensure of seasonal inactivated influenza vaccines [Internet]. 2007. Available: https://www.fda.gov/downloads/BiologicsBloodVaccines/GuidanceComplianceRegulatoryInformation/Guidances/Vaccines/UCM091985.pdf
51. Marcelin G, DuBois R, Rubrum A, Russell CJ, McElhaney JE, Webby RJ. A contributing role for anti-neuraminidase antibodies on immunity to pandemic H1N1 2009 influenza a virus. PLoS One. 2011;6.
52. Waffarn EE, Baumgarth N. Protective B cell responses to flu-no fluke! J Immunol. American Association of Immunologists; 2011;186 : 3823–9. Available: http://www.ncbi.nlm.nih.gov/pubmed/21422252
53. Huleatt JW, Nakaar V, Desai P, Huang Y, Hewitt D, Jacobs A, et al. Potent immunogenicity and efficacy of a universal influenza vaccine candidate comprising a recombinant fusion protein linking influenza M2e to the TLR5 ligand flagellin. Vaccine. 2008;26 : 201–214. Available: https://ac-els-cdn-com.are.uab.cat/S0264410X0701256X/1-s2.0-S0264410X0701256X-main.pdf?_tid=5a417b66-c2a7-4b41-9691-6458f6ca24b4&acdnat=1539249338_b6c98425e9a7c6a2a6571dbb944df61d doi: 10.1016/j.vaccine.2007.10.062 18063235
54. Honko AN, Sriranganathan N, Lees CJ, Mizel SB. Flagellin is an effective adjuvant for immunization against lethal respiratory challenge with Yersinia pestis. Infect Immun. 2006;74 : 1113–1120. Available: https://www.ncbi.nlm.nih.gov/pmc/articles/PMC1360354/pdf/1506-05.pdf doi: 10.1128/IAI.74.2.1113-1120.2006 16428759
55. McDonald WF, Huleatt JW, Foellmer HG, Hewitt D, Tang J, Desai P, et al. A West Nile virus recombinant protein vaccine that coactivates innate and adaptive immunity. J Infect Dis. Oxford University Press; 2007;195 : 1607–1617. Available: doi: 10.1086/517613 17471430
56. Delaney KN, Phipps JP, Johnson JB, Mizel SB. A recombinant flagellin-poxvirus fusion protein vaccine elicits complement-dependent protection against respiratory challenge with vaccinia virus in mice. Viral Immunol. Mary Ann Liebert, Inc.; 2010;23 : 201–10. Available: http://www.ncbi.nlm.nih.gov/pubmed/20374000
57. Weimer ET, Ervin SE, Wozniak DJ, Mizel SB. Immunization of young African green monkeys with OprF epitope 8-OprI-type A - and B-flagellin fusion proteins promotes the production of protective antibodies against nonmucoid Pseudomonas aeruginosa. Vaccine. Elsevier; 2009;27 : 6762–6769. Available: https://www-sciencedirect-com.are.uab.cat/science/article/pii/S0264410X09012754?via%3Dihub doi: 10.1016/j.vaccine.2009.08.080 19744586
58. Farina C, Theil D, Semlinger B, Hohlfeld R, Meinl E. Distinct responses of monocytes to Toll-like receptor ligands and inflammatory cytokines. Int Immunol. Oxford University Press; 2004;16 : 799–809. Available: doi: 10.1093/intimm/dxh083 15096475
59. Caron G, Duluc D, Frémaux I, Jeannin P, David C, Gascan H, et al. Direct stimulation of human T cells via TLR5 and TLR7/8: flagellin and R-848 up-regulate proliferation and IFN-gamma production by memory CD4+ T cells. J Immunol. American Association of Immunologists; 2005;175 : 1551–7. Available: http://www.ncbi.nlm.nih.gov/pubmed/16034093 doi: 10.4049/jimmunol.175.3.1551 16034093
60. Song L, Zhang Y, Yun NE, Poussard AL, Smith JN, Smith JK, et al. Superior efficacy of a recombinant flagellin:H5N1 HA globular head vaccine is determined by the placement of the globular head within flagellin. 2009;27 : 5875–5884. Available: https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3571653/pdf/nihms-440739.pdf doi: 10.1016/j.vaccine.2009.07.060 19654064
61. Wang BZ, Xu R, Quan FS, Kang SM, Wang L, Compans RW. Intranasal immunization with influenza VLPs incorporating membrane-anchored flagellin induces strong heterosubtypic protection. PLoS One. 2010;5.
62. Liu G, Tarbet B, Song L, Reiserova L, Weaver B, Chen Y, et al. Immunogenicity and efficacy of flagellin-fused vaccine candidates targeting 2009 pandemic H1N1 influenza in mice. PLoS One. 2011;6.
63. Liu G, Song L, Reiserova L, Trivedi U, Li H, Liu X, et al. Flagellin-HA vaccines protect ferrets and mice against H5N1 highly pathogenic avian influenza virus (HPAIV) infections. Vaccine. Elsevier Ltd; 2012;30 : 6833–6838. Available: http://dx.doi.org/10.1016/j.vaccine.2012.09.013
64. Tsybalova LM, Stepanova LA, Shuklina MA, Mardanova ES, Kotlyarov RY, Potapchuk M V, et al. Combination of M2e peptide with stalk HA epitopes of influenza A virus enhances protective properties of recombinant vaccine. PLoS One. 2018;13. Available: https://doi.org/10.1371/journal.pone.0201429
65. Olsen CW. DNA vaccination against influenza viruses: A review with emphasis on equine and swine influenza. Vet Microbiol. 2000;74 : 149–164. doi: 10.1016/s0378-1135(00)00175-9 10799787
66. Wang S, Zhang C, Zhang L, Li J, Huang Z, Lu S. The relative immunogenicity of DNA vaccines delivered by the intramuscular needle injection, electroporation and gene gun methods. Vaccine. 2008;26 : 2100–2110. doi: 10.1016/j.vaccine.2008.02.033 18378365
67. Raz E, Carson DA, Parker SE, Parr TB, Abai AM, Aichinger G, et al. Intradermal gene immunization: the possible role of DNA uptake in the induction of cellular immunity to viruses. Proc Natl Acad Sci U S A. 1994;91 : 9519–23. Available: http://www.pubmedcentral.nih.gov/articlerender.fcgi?artid=44844&tool=pmcentrez&rendertype=abstract doi: 10.1073/pnas.91.20.9519 7937799
68. Young F, Marra F. A systematic review of intradermal influenza vaccines. Vaccine. Elsevier Ltd; 2011;29 : 8788–8801. Available: doi: 10.1016/j.vaccine.2011.09.077 21968444
69. Borggren M, Nielsen J, Karlsson I, Dalgaard TS, Trebbien R, Williams JA, et al. A polyvalent influenza DNA vaccine applied by needle-free intradermal delivery induces cross-reactive humoral and cellular immune responses in pigs. Vaccine. Elsevier Ltd; 2016;34 : 3634–3640. Available: doi: 10.1016/j.vaccine.2016.05.030 27211039
70. Brookes SM, Núñez A, Choudhury B, Matrosovich M, Essen SC. Replication, pathogenesis and transmission of pandemic (H1N1) 2009 virus in non-immune pigs. PLoS One. 2009;5. Available: www.plosone.org
71. Lange E, Kalthoff D, Blohm U, Teifke JP, Breithaupt A, Maresch C, et al. Pathogenesis and transmission of the novel swine-origin influenza virus A/H1N1 after experimental infection of pigs. J Gen Virol. Microbiology Society; 2009;90 : 2119–2123. Available: http://jgv.microbiologyresearch.org/content/journal/jgv/10.1099/vir.0.014480-0 19592456
72. Renegar KB, Small PA, Boykins LG, Wright PF. Role of IgA versus IgG in the control of influenza viral infection in the murine respiratory tract. J Immunol. 2004;173 : 1978–1986. Available: http://www.jimmunol.org/content/173/3/1978http://www.jimmunol.org/content/173/3/1978.full#ref-list-1 doi: 10.4049/jimmunol.173.3.1978 15265932
73. He W, Mullarkey CE, Duty JA, Moran TM, Palese P, Miller MS. Broadly neutralizing anti-influenza virus antibodies: enhancement of neutralizing potency in polyclonal mixtures and IgA backbones. J Virol. American Society for Microbiology (ASM); 2015;89 : 3610–8. Available: http://www.ncbi.nlm.nih.gov/pubmed/25589655 doi: 10.1128/JVI.03099-14 25589655
74. Hervé PL, Raliou M, Bourdieu C, Dubuquoy C, Petit-Camurdan A, Bertho N, et al. A novel subnucleocapsid nanoplatform for mucosal vaccination against influenza virus that targets the ectodomain of matrix protein 2. J Virol. 2014;88 : 325–338. Available: https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3911713/pdf/zjv325.pdf doi: 10.1128/JVI.01141-13 24155388
75. Shim BS, Choi YK, Yun CH, Lee EG, Jeon YS, Park SM, et al. Sublingual immunization with M2-based vaccine induces broad protective immunity against influenza. PLoS One. Public Library of Science; 2011;6. Available: http://www.ncbi.nlm.nih.gov/pubmed/22140491
76. Okutani M, Tsukahara T, Kato Y, Fukuta K, Inoue R. Gene expression profiles of CD4/CD8 double-positive T cells in porcine peripheral blood. Anim Sci J. Wiley/Blackwell (10.1111); 2018;89 : 979–987. Available: doi: 10.1111/asj.13021 29740910
Článek Drink driving engagement in women: An exploration of context, hazardous alcohol use, and behaviourČlánek Rare earth elements in paddy fields from eroded granite hilly land in a southern China watershedČlánek Effect of calcium glucoheptonate on proliferation and osteogenesis of osteoblast-like cells in vitroČlánek Unexpected sawtooth artifact in beat-to-beat pulse transit time measured from patient monitor dataČlánek Vibrational behavior of psyllids (Hemiptera: Psylloidea): Functional morphology and mechanismsČlánek Free will beliefs are better predicted by dualism than determinism beliefs across different culturesČlánek The anatomy of a crushing bite: The specialised cranial mechanics of a giant extinct kangarooČlánek The genetic alteration spectrum of the SWI/SNF complex: The oncogenic roles of BRD9 and ACTL6AČlánek Myotendinous asymmetries derived from the prolonged practice of badminton in professional playersČlánek Identification of bovine CpG SNPs as potential targets for epigenetic regulation via DNA methylationČlánek Genetic variability and consequence of Mycobacterium tuberculosis lineage 3 in Kampala-UgandaČlánek Residual stenosis after carotid artery stenting: Effect on periprocedural and long-term outcomesČlánek uORF-Tools—Workflow for the determination of translation-regulatory upstream open reading framesČlánek Medicine and the media: Medical experts’ problems and solutions while working with journalistsČlánek Primary hyperhidrosis prevalence and characteristics among medical students in Rio de JaneiroČlánek Antibacterial activity of silver nanoparticles of different particle size against Vibrio NatriegensČlánek Study on Dalfampridine in the treatment of Multiple Sclerosis Mobility Disability: A meta-analysisČlánek Association between the posterior part of the circle of Willis and the vertebral artery hypoplasiaČlánek Lymphocyte proliferation induced by high-affinity peptides for HLA-B*51:01 in Behçet’s uveitisČlánek Inhibition of gap junctional intercellular communication by an anti-migraine agent, flunarizineČlánek The intake pattern and feed preference of layer hens selected for high or low feed conversion ratioČlánek Individualized pattern recognition for detecting mind wandering from EEG during live lecturesČlánek Endothelial dysfunction and low-grade inflammation in the transition to renal replacement therapyČlánek Feeling the heat: Elevated temperature affects male display activity of a lekking grassland birdČlánek A zero-shot learning approach to the development of brain-computer interfaces for image retrievalČlánek Correction: The mean cell volume difference (dMCV) reflects serum hypertonicity in diabetic dogsČlánek Supplementation strategies affect the feed intake and performance of grazing replacement heifersČlánek Prediction of cardiovascular disease risk among people with severe mental illness: A cohort studyČlánek Factors influencing the admission decision for Medical Psychiatry Units: A concept mapping approachČlánek Physiological stress reactivity and recovery related to behavioral traits in dogs (Canis familiaris)Článek Correction: Unraveling the genetic complexity underlying sorghum response to water availabilityČlánek Is this a man’s world? The effect of gender diversity and gender equality on firm innovativenessČlánek Human cord blood (hCB)-CD34+ humanized mice fail to reject human acute myeloid leukemia cellsČlánek Correction: The prognosis of heart failure patients: Does sodium level play a significant role?Článek Correction: Age, sex and storage time influence hair cortisol levels in a wild mammal populationČlánek The impact of admission serum lactate on children with moderate to severe traumatic brain injuryČlánek PTP1B negatively regulates nitric oxide-mediated Pseudomonas aeruginosa killing by neutrophilsČlánek Ecophysiological impacts of Esca, a devastating grapevine trunk disease, on Vitis vinifera L.Článek Correction: Lkb1 Deficiency Alters Goblet and Paneth Cell Differentiation in the Small IntestineČlánek Synteny and phylogenetic analysis of paralogous thyrostimulin beta subunits (GpB5) in vertebratesČlánek The conditional Fama-French model and endogenous illiquidity: A robust instrumental variables testČlánek Structural characterization of EGFR exon 19 deletion mutation using molecular dynamics simulationČlánek Differences in the impedance of cochlear implant devices within 24 hours of their implantationČlánek Changing educational gradient in long-term care-free life expectancy among German men, 1997-2012Článek Organic resolution function and effects of platinum nanoparticles on bacteria and organic matterČlánek Genetically distinct Group B Streptococcus strains induce varying macrophage cytokine responsesČlánek National trends in inpatient endometriosis admissions: Patients, procedures and outcomes, 2006−2015Článek Predictors of SLE relapse in pregnancy and post-partum among multi-ethnic patients in MalaysiaČlánek Dysregulation of microRNAs and target genes networks in human abdominal aortic aneurysm tissuesČlánek Time-related immunomodulation by stressors and corticosterone transdermal application in toadsČlánek Retraction: Adaptive double threshold energy detection based on Markov model for cognitive radioČlánek Out-of-pocket health spending among Medicare beneficiaries: Which chronic diseases are most costly?Článek Lipidome profiles of postnatal day 2 vaginal swabs reflect fat composition of gilt’s postnatal dietČlánek Human papillomavirus infection among head and neck squamous cell carcinomas in southern ChinaČlánek Quartet-based inference of cell differentiation trees from ChIP-Seq histone modification dataČlánek The genome of Alcaligenes aquatilis strain BU33N: Insights into hydrocarbon degradation capacityČlánek LMX1A inhibits C-Myc expression through ANGPTL4 to exert tumor suppressive role in gastric cancerČlánek Global smoking trends in inflammatory bowel disease: A systematic review of inception cohortsČlánek A review of the elusive bicolored iris Snouted Treefrogs (Anura: Hylidae:Scinax uruguayus group)Článek Development of peptide biosensor for the detection of dengue fever biomarker, nonstructural 1Článek Advancing computational biology and bioinformatics research through open innovation competitionsČlánek A mutation in mouse Krüppel-like factor 15 alters the gut microbiome and response to obesogenic dietČlánek The CrowdWater game: A playful way to improve the accuracy of crowdsourced water level class dataČlánek A high-density exome capture genotype-by-sequencing panel for forestry breeding in Pinus radiataČlánek Self-management action and motivation of Pacific adults in New Zealand with end-stage renal diseaseČlánek The erythrocyte membrane stability is associated with sleep time and social jetlag in shift workersČlánek In-hospital cardiopulmonary resuscitation of patients with cirrhosis: A population-based analysisČlánek The ‘Saw but Forgot’ error: A role for short-term memory failures in understanding junction crashes?Článek Effects of inorganic nitrogen and litters of Masson Pine on soil organic carbon decompositionČlánek Spatiotemporal clustering of malaria in southern-central Ethiopia: A community-based cohort studyČlánek Post-translational S-glutathionylation of cofilin increases actin cycling during cocaine seekingČlánek Dorsal tongue porphyrin autofluorescence and Candida saprophytism: A prospective observational studyČlánek Correction: Reward abundance interferes with error-based learning in a visuomotor adaptation taskČlánek Metabolisable energy content in canine and feline foods is best predicted by the NRC2006 equationČlánek Sign and goal tracker rats process differently the incentive salience of a conditioned stimulusČlánek Resource consumption of multi-substance users in the emergency room: A neglected patient groupČlánek Modeling spatial variation in density of golden eagle nest sites in the western United StatesČlánek Correction: Development of a high-throughput assay to measure measles neutralizing antibodiesČlánek Research on multi-agent genetic algorithm based on tabu search for the job shop scheduling problemČlánek Cinobufacini ameliorates experimental colitis via modulating the composition of gut microbiotaČlánek DKK1 promotes hepatocellular carcinoma inflammation, migration and invasion: Implication of TGF-β1
Článek vyšel v časopisePLOS One
Nejčtenější tento týden
2019 Číslo 9- Zachyťte pacienty s akutními porfyriemi, aby nebloudili zdravotnictvím
- Auris One: Když se dokumentace v ordinaci praktika začne psát „sama“
- „Jednohubky“ z klinického výzkumu – 2026/11
- Prof. Jan Škrha: Metformin je bezpečný, ale je třeba jej bezpečně užívat a léčbu kontrolovat
- Fotoprotekce za hranicí SPF: Jak se efektivně bránit skryté hrozbě ultradlouhovlnného UVA záření?
-
Všechny články tohoto čísla
- "The dead shall be raised": Multidisciplinary analysis of human skeletons reveals complexity in 19th century immigrant socioeconomic history and identity in New Haven, Connecticut
- Characterization of ecto- and endoparasite communities of wild Mediterranean teleosts by a metabarcoding approach
- Drink driving engagement in women: An exploration of context, hazardous alcohol use, and behaviour
- The effect of birth weight on body composition: Evidence from a birth cohort and a Mendelian randomization study
- Dolutegravir based antiretroviral therapy compared to other combined antiretroviral regimens for the treatment of HIV-infected naive patients: A systematic review and meta-analysis
- Expression profile of genes encoding allatoregulatory neuropeptides in females of the spider Parasteatoda tepidariorum (Araneae, Theridiidae)
- “My life after stroke through a camera lens”- A photovoice study on participation in Sweden
- Bacterial community composition of biofilms in milking machines of two dairy farms assessed by a combination of culture-dependent and –independent methods
- Health differences between multiple and single job holders in precarious employment in the Netherlands: A cross-sectional study among Dutch workers
- Clinical evaluation and budget impact analysis of cervical cancer screening using cobas 4800 HPV screening technology in the public sector of South Africa
- Rare earth elements in paddy fields from eroded granite hilly land in a southern China watershed
- High-throughput sequencing analysis of microbial community diversity in response to indica and japonica bar-transgenic rice paddy soils
- Physiological and molecular responses to drought stress in teak (Tectona grandis L.f.)
- Long-term performance of an atrial lead capable of accelerometer based detection of cardiac contractility in patients receiving cardiac resynchronisation therapy
- Ectomycorrhizal fungal communities of secondary tropical forests dominated by Tristaniopsis in Bangka Island, Indonesia
- Downregulation of hippocampal NR2A/2B subunits related to cognitive impairment in a pristane-induced lupus BALB/c mice
- Demonstrating specificity of bioactive peptide nucleic acids (PNAs) targeting microRNAs for practical laboratory classes of applied biochemistry and pharmacology
- Xenopus fraseri: Mr. Fraser, where did your frog come from?
- Competing priorities and second chances - A qualitative exploration of prisoners’ journeys through the Hepatitis C continuum of care
- Evaluating coral trophic strategies using fatty acid composition and indices
- Amyloid β oligomers inhibit growth of human cancer cells
- Distraction of olfactory bulb-medial prefrontal cortex circuit may induce anxiety-like behavior in allergic rhinitis
- Hormonal, metabolic and inflammatory circulating biomarker profiles in obese and non-obese Brazilian middle-aged women
- 'He usually has what we call normal fevers’: Cultural perspectives on healthy child growth in rural Southeastern Tanzania: An ethnographic enquiry
- Anatomical connections underlying personally-familiar face processing
- Fe limitation decreases transcriptional regulation over the diel cycle in the model diatom Thalassiosira pseudonana
- Fructose-1,6-bisphosphate prevents pulmonary fibrosis by regulating extracellular matrix deposition and inducing phenotype reversal of lung myofibroblasts
- Correction: Development of interval-valued fuzzy GRA with SERVPERF based on subjective and objective weights for evaluation of airline service quality: A case study of Korea low-cost carriers
- Anatomical analysis of antebrachial cutaneous nerve distribution pattern and its clinical implications for sensory reconstruction
- Characterization of doxycycline-dependent inducible Simian Virus 40 large T antigen immortalized human conjunctival epithelial cell line
- Topographic correlation and asymmetry analysis of ganglion cell layer thinning and the retinal nerve fiber layer with localized visual field defects
- Structuring a conceptual model for cost-effectiveness analysis of frailty interventions
- Characteristics of sarcopenia after distal gastrectomy in elderly patients
- Action spectrum for photoperiodic control of thyroid-stimulating hormone in Japanese quail (Coturnix japonica)
- The determinants of lung cancer after detecting a solitary pulmonary nodule are different in men and women, for both chest radiograph and CT
- Taste perception and oral microbiota are associated with obesity in children and adolescents
- Target women: Equity in access to mHealth technology in a non-communicable disease care intervention in Kenya
- Correction: Attitudes to and experiences with body weight control and changes in body weight in relation to all-cause mortality in the general population
- Homogenous HIV-1 subtype B from the Brazilian Amazon with infrequent diverse BF1 recombinants, subtypes F1 and C among blood donors
- Glucocorticoid stimulation increases cardiac contractility by SGK1-dependent SOCE-activation in rat cardiac myocytes
- Loss of control as a violation of expectations: Testing the predictions of a common inconsistency compensation approach in an inclusionary cyberball game
- Living on the edge - circadian habitat usage in pre-weaning European hares (Lepus europaeus) in an intensively used agricultural area
- NMDA receptor activation induces long-term potentiation of glycine synapses
- Antibody response in snakes with boid inclusion body disease
- Can they imagine the future? A qualitative study exploring the skills employers seek in pharmaceutical sciences doctoral graduates
- Affirmative citation bias in scientific myth debunking: A three-in-one case study
- Streaming chunk incremental learning for class-wise data stream classification with fast learning speed and low structural complexity
- Time trends in healthy lifestyle among adults in Germany: Results from three national health interview and examination surveys between 1990 and 2011
- The impact of door-to-electrocardiogram time on door-to-balloon time after achieving the guideline-recommended target rate
- A systematic review and network meta-analysis of existing pharmacologic therapies in patients with idiopathic sudden sensorineural hearing loss
- Effect of calcium glucoheptonate on proliferation and osteogenesis of osteoblast-like cells in vitro
- CCR2 knockout ameliorates obesity-induced kidney injury through inhibiting oxidative stress and ER stress
- Multi-method assessment of whale shark (Rhincodon typus) residency, distribution, and dispersal behavior at an aggregation site in the Red Sea
- Duration of symptoms in the quantification of upper limb disability and impairment for individuals with mild degenerative cervical myelopathy (DCM)
- Expression of genes in the skeletal muscle of individuals with cachexia/sarcopenia: A systematic review
- Correction: Alopecia areata patients show deficiency of FOXP3+CD39+ T regulatory cells and clonotypic restriction of Treg TCRβ-chain, which highlights the immunopathological aspect of the disease
- Alcohol, tobacco and cannabis use are associated with job loss at follow-up: Findings from the CONSTANCES cohort
- Estimation of the incidence of animal rabies in Punjab, India
- G-protein-coupled receptor 40 agonist GW9508 potentiates glucose-stimulated insulin secretion through activation of protein kinase Cα and ε in INS-1 cells
- Reasons behind stymied public hospital governance reform in China
- Cognitive and social congruence in peer-assisted learning – A scoping review
- The wing of the ToxR winged helix-turn-helix domain is required for DNA binding and activation of toxT and ompU
- Associations between sexual activity and weight status: Findings from the English Longitudinal Study of Ageing
- Knowledge and practices regarding toxoplasmosis in housewives: A cross sectional study in a northern Mexican city
- Citation gaming induced by bibliometric evaluation: A country-level comparative analysis
- Can we predict which species win when new habitat becomes available?
- Wetlands are keystone habitats for jaguars in an intercontinental biodiversity hotspot
- Research applications of primary biodiversity databases in the digital age
- The Edinburgh Postpartum Depression Scale: Stable structure but subscale of limited value to detect anxiety
- EV71 3C protease induces apoptosis by cleavage of hnRNP A1 to promote apaf-1 translation
- Post-exercise high-sensitivity troponin T levels in patients with suspected unstable angina
- Unexpected sawtooth artifact in beat-to-beat pulse transit time measured from patient monitor data
- Development of highly sensitive and low-cost DNA agarose gel electrophoresis detection systems, and evaluation of non-mutagenic and loading dye-type DNA-staining reagents
- Human mesenchymal stromal cells ameliorate complement induced inflammatory cascade and improve renal functions in a rat model of ischemia-reperfusion induced acute kidney injury
- Macrophage phenotype and its relationship with renal function in human diabetic nephropathy
- Phylogeography of the dugong (Dugong dugon) based on historical samples identifies vulnerable Indian Ocean populations
- Vibrational behavior of psyllids (Hemiptera: Psylloidea): Functional morphology and mechanisms
- Evaluation of the effectiveness and equity of the maternity protection reform in Chile from 2000 to 2015
- Baseline human gut microbiota profile in healthy people and standard reporting template
- Are screening methods useful in feature selection? An empirical study
- Free will beliefs are better predicted by dualism than determinism beliefs across different cultures
- How does the content of nutrients in soil affect the health status of trees in city parks?
- Understanding the intricacy of canid social systems: Structure and temporal stability of red fox (Vulpes vulpes) groups
- The anatomy of a crushing bite: The specialised cranial mechanics of a giant extinct kangaroo
- Nurse-led medicines’ monitoring in care homes, implementing the Adverse Drug Reaction (ADRe) Profile improvement initiative for mental health medicines: An observational and interview study
- Projecting burden of hypertension and its management in Turkey, 2015-2030
- Polyamine biosynthesis in Xenopus laevis: the xlAZIN2/xlODC2 gene encodes a lysine/ornithine decarboxylase
- Cytokines in agitated and non-agitated patients admitted to an acute psychiatric department: A cross-sectional study
- Acute pancreatitis risk after kidney transplantation: Propensity score matching analysis of a national cohort
- Understanding the effect of producers’ attitudes, perceived norms, and perceived behavioral control on intentions to use antimicrobials prudently on New York dairy farms
- Safety assessment of a novel C-type natriuretic peptide derivative and the mechanism of bone- and cartilage-specific toxicity
- Theory of mind in remitted bipolar disorder: Interpersonal accuracy in recognition of dynamic nonverbal signals
- Graviola (Annona muricata) attenuates behavioural alterations and testicular oxidative stress induced by streptozotocin in diabetic rats
- Ecological conditions experienced by offspring during pregnancy and early post-natal life determine mandible size in roe deer
- Calculation of the contribution rate of China’s hydraulic science and technology based on a feedforward neural network
- ViraMiner: Deep learning on raw DNA sequences for identifying viral genomes in human samples
- The absence of interleukin 10 affects the morphology, differentiation, granule content and the production of cryptidin-4 in Paneth cells in mice
- Relationship between Helicobacter pylori infection and obesity in Chinese adults: A systematic review with meta-analysis
- Moving model analysis on the transient pressure and slipstream caused by a metro train passing through a tunnel
- The importance of assigning responsibility during evaluation in order to increase student satisfaction from physical education classes: A structural equation model
- Lower dormancy with rapid germination is an important strategy for seeds in an arid zone with unpredictable rainfall
- Gene Cascade Finder: A tool for identification of gene cascades and its application in Caenorhabditis elegans
- Proteomics approach to identify serum biomarkers associated with the progression of diabetes in Korean patients with abdominal obesity
- Malaria vaccine candidates displayed on novel virus-like particles are immunogenic and induce transmission-blocking activity
- Transcriptome analysis of a nematode resistant and susceptible upland cotton line at two critical stages of Meloidogyne incognita infection and development
- Identification of variant HIV envelope proteins with enhanced affinities for precursors to anti-gp41 broadly neutralizing antibodies
- Distinguishing mild cognitive impairment from healthy aging and Alzheimer’s Disease: The contribution of the INECO Frontal Screening (IFS)
- Novel application of amino-acid buffered solution for neuroprotection against ischemia/reperfusion injury
- Are unpopular children more likely to get sick? Longitudinal links between popularity and infectious diseases in early childhood
- Vegetation communities on commercial developments are heterogenous and determined by development and landscaping decisions, not socioeconomics
- Falls among community-dwelling older adults in Ethiopia; A preliminary cross-sectional study
- Retraction: Social success of perfumes
- The effect of ethyl alcohol on the severity of injuries in fatal pedestrian victims of traffic crashes
- Drought stress has transgenerational effects on soybean seed germination and seedling vigor
- Prevalence of benign osseous lesions of the spine and association with spinal pain in the general population in whole body MRI
- Age-related differences of inter-joint coordination in elderly during squat jumping
- Isolation of five Enterobacteriaceae species harbouring blaNDM-1 and mcr-1 plasmids from a single paediatric patient
- Diagnostic performance and image quality of iterative model-based reconstruction of coronary CT angiography using 100 kVp for heavily calcified coronary vessels
- CAC1 knockdown reverses drug resistance through the downregulation of P-gp and MRP-1 expression in colorectal cancer
- Getting your game on: Using virtual reality to improve real table tennis skills
- Microbiological contamination of young children’s hands in rural Bangladesh: Associations with child age and observed hand cleanliness as proxy
- Expansion of the agricultural frontier in the largest South American Dry Forest: Identifying priority conservation areas for snakes before everything is lost
- Utility of lung ultrasound in ANCA-associated vasculitis with lung involvement
- Aerial surveys cause large but ephemeral decreases in bear presence at salmon streams in Kodiak, Alaska
- Exposure to particle debris generated from passenger and truck tires induces different genotoxicity and inflammatory responses in the RAW 264.7 cell line
- Influence of the cultivation medium and pH on the pigmentation of Trichophyton rubrum
- Intra-arterial catheter-directed CT angiography for assessment of endovascular aortic aneurysm repair
- Association of antibiotic exposure with the mortality in metastatic colorectal cancer patients treated with bevacizumab-containing chemotherapy: A hospital-based retrospective cohort study
- The genetic alteration spectrum of the SWI/SNF complex: The oncogenic roles of BRD9 and ACTL6A
- Plasma chemistry in nesting leatherback sea turtles (Dermochelys coriacea) from Florida: Understanding the importance of sample hemolysis effects on blood analytes
- Myotendinous asymmetries derived from the prolonged practice of badminton in professional players
- Computational tools to detect signatures of mutational processes in DNA from tumours: A review and empirical comparison of performance
- Exposure to lipopolysaccharide (LPS) reduces contractile response of small airways from GSTCD-/- mice
- Generation of a protective murine monoclonal antibody against the stem of influenza hemagglutinins from group 1 viruses and identification of resistance mutations against it
- Comparative compositional and functional analyses of Bothrops moojeni specimens reveal several individual variations
- Radiation hardness of cadmium telluride solar cells in proton therapy beam mode
- Bourdieu, networks, and movements: Using the concepts of habitus, field and capital to understand a network analysis of gender differences in undergraduate physics
- A 32-channel parallel transmit system add-on for 7T MRI
- Comparison between Aptima Assays (Hologic) and the Allplex STI Essential Assay (Seegene) for the diagnosis of Sexually transmitted infections
- Knowledge gaps of STIs in Africa; Systematic review
- Correction: Bovine herpesvirus 1 can cross the intact zona pellucida of bovine oocytes after artificial infection
- Distribution of corneal spherical aberration in a Tanzanian population
- Correction: Determinants of physical activity: A path model based on an ecological model of active living
- Wild pollinator activity negatively related to honey bee colony densities in urban context
- Subclinical alterations in left ventricular structure and function according to obesity and metabolic health status
- The epidemiological signature of influenza B virus and its B/Victoria and B/Yamagata lineages in the 21st century
- Identification of bovine CpG SNPs as potential targets for epigenetic regulation via DNA methylation
- Nitric oxide regulates the expression of heme carrier protein-1 via hypoxia inducible factor-1α stabilization
- Development of highly efficient protocols for extraction and amplification of cytomegalovirus DNA from dried blood spots for detection and genotyping of polymorphic immunomodulatory genes
- Construction of pseudomolecule sequences of Brassica rapa ssp. pekinensis inbred line CT001 and analysis of spontaneous mutations derived via sexual propagation
- Effects of flavoring compounds used in electronic cigarette refill liquids on endothelial and vascular function
- Rural pipeline and willingness to work in rural areas: Mixed method study on students in midwifery and obstetric nursing in Mali
- Role of phospholipase A2 receptor 1 antibody level at diagnosis for long-term renal outcome in membranous nephropathy
- Prevalence of anemia in diabetic adult outpatients in Northeast Ethiopia
- Characterization of melanin and optimal conditions for pigment production by an endophytic fungus, Spissiomyces endophytica SDBR-CMU319
- Genetic variability and consequence of Mycobacterium tuberculosis lineage 3 in Kampala-Uganda
- Comparison of in vitro and computational experiments on the relation of inter-beat interval and duration of repolarization in a specific type of human induced pluripotent stem cell-derived cardiomyocytes
- Current and potential contributions of community pharmacy teams to self-harm and suicide prevention: A qualitative interview study
- Prediction of risk scores for colorectal cancer patients from the concentration of proteins involved in mitochondrial apoptotic pathway
- With or without U(K): A pre-Brexit network analysis of the EU ETS
- Graph-theoretical analysis for energy landscape reveals the organization of state transitions in the resting-state human cerebral cortex
- Task-uninformative visual stimuli improve auditory spatial discrimination in humans but not the ideal observer
- Residual stenosis after carotid artery stenting: Effect on periprocedural and long-term outcomes
- gapFinisher: A reliable gap filling pipeline for SSPACE-LongRead scaffolder output
- A plant biostimulant made from the marine brown algae Ascophyllum nodosum and chitosan reduce Fusarium head blight and mycotoxin contamination in wheat
- Monte-Carlo value analysis of High-Throughput Satellites: Value levers, tradeoffs, and implications for operators and investors
- Educational and health outcomes associated with bronchopulmonary dysplasia in 15-year-olds born preterm
- Loss of prostatic acid phosphatase and α-synuclein cause motor circuit degeneration without altering cerebellar patterning
- Neuropathy and neural plasticity in the subcutaneous white adipose depot
- Roles of differential expression of miR-543-5p in GH regulation in rat anterior pituitary cells and GH3 cells
- The enemy’s gaze: Immersive virtual environments enhance peace promoting attitudes and emotions in violent intergroup conflicts
- Protective effect of lactobacillus plantarum on alcoholic liver injury and regulating of keap-Nrf2-ARE signaling pathway in zebrafish larvae
- Koopman Mode Analysis of agent-based models of logistics processes
- Empirical mode decomposition based long short-term memory neural network forecasting model for the short-term metro passenger flow
- Male sexual dysfunction in obesity: The role of sex hormones and small fibre neuropathy
- Multi-agent reinforcement learning with approximate model learning for competitive games
- Identification of olfactory genes and functional analysis of BminCSP and BminOBP21 in Bactrocera minax
- The use of urinary fluoride excretion to facilitate monitoring fluoride intake: A systematic scoping review
- Development of a family caregiver needs-assessment scale for end-of-life care for senility at home (FADE)
- Epidemiology of pneumonia in the pre-pneumococcal conjugate vaccine era in children 2-59 months of age, in Ulaanbaatar, Mongolia, 2015-2016
- H-EM: An algorithm for simultaneous cell diameter and intensity quantification in low-resolution imaging cytometry
- Public expenditure on Non-Communicable Diseases & Injuries in India: A budget-based analysis
- Doxorubicin induces trans-differentiation and MMP1 expression in cardiac fibroblasts via cell death-independent pathways
- uORF-Tools—Workflow for the determination of translation-regulatory upstream open reading frames
- Comparative analysis of postural control and vertical jump performance between three different measurement devices
- Hierarchical multi-view aggregation network for sensor-based human activity recognition
- Clavien–Dindo classification for grading complications after total pharyngolaryngectomy and free jejunum transfer
- Significantly different expression levels of microRNAs associated with vascular invasion in hepatocellular carcinoma and their prognostic significance after surgical resection
- Clinical correlates of workplace injury occurrence and recurrence in adults
- Medicine and the media: Medical experts’ problems and solutions while working with journalists
- Phylogenic classification and virulence genes profiles of uropathogenic E. coli and diarrhegenic E. coli strains isolated from community acquired infections
- Genetic relatedness in carbapenem-resistant isolates from clinical specimens in Ghana using ERIC-PCR technique
- Forest resilience under global environmental change: Do we have the information we need? A systematic review
- Improving the production of podophyllotoxin in hairy roots of Hyptis suaveolens induced from regenerated plantlets
- Controls on planktonic foraminifera apparent calcification depths for the northern equatorial Indian Ocean
- Notch and Delta are required for survival of the germline stem cell lineage in testes of Drosophila melanogaster
- Children with HIV: A scoping review of auditory processing skills
- Correction: Two distinct actin waves correlated with turns-and-runs of crawling microglia
- Expression of Concern: Neurotoxicity Induced by Bupivacaine via T-Type Calcium Channels in SH-SY5Y Cells
- Sex-dependent and -independent transcriptional changes during haploid phase gametogenesis in the sugar kelp Saccharina latissima
- Vehicle modeling for the analysis of the response of detectors based on inductive loops
- New Mycobacteroides abscessus subsp. massiliense strains with recombinant hsp65 gene laterally transferred from Mycobacteroides abscessus subsp. abscessus: Potential for misidentification of M. abscessus strains with the hsp65-based method
- A prognostic Bayesian network that makes personalized predictions of poor prognostic outcome post resection of pancreatic ductal adenocarcinoma
- Impact of care provider network characteristics on patient outcomes: Usage of social network analysis and a multi-scale community detection
- Valid group comparisons can be made with the Patient Health Questionnaire (PHQ-9): A measurement invariance study across groups by demographic characteristics
- Comparison of risk models for mortality and cardiovascular events between machine learning and conventional logistic regression analysis
- Upgraded molecular models of the human KCNQ1 potassium channel
- Mental health and quality of life outcomes in family members of patients with chronic critical illness admitted to the intensive care units of two Brazilian hospitals serving the extremes of the socioeconomic spectrum
- Correction: Secretome profiling of PC3/nKR cells, a novel highly migrating prostate cancer subline derived from PC3 cells
- The extraordinary osteology and functional morphology of the limbs in Palorchestidae, a family of strange extinct marsupial giants
- Primary hyperhidrosis prevalence and characteristics among medical students in Rio de Janeiro
- Implementation of home blood pressure monitoring among French GPs: A long and winding road
- In vitro and molecular chemosensitivity in human cholangiocarcinoma tissues
- Saiga horn user characteristics, motivations, and purchasing behaviour in Singapore
- The health and cost burden of antibiotic resistant and susceptible Escherichia coli bacteraemia in the English hospital setting: A national retrospective cohort study
- Retraction: Comprehensive Comparison of Three Different Immunosuppressive Regimens for Liver Transplant Patients with Hepatocellular Carcinoma: Steroid-Free Immunosuppression, Induction Immunosuppression and Standard Immunosuppression
- Can acute suicidality be predicted by Instagram data? Results from qualitative and quantitative language analyses
- Computational and experimental analysis of the glycophosphatidylinositol-anchored proteome of the human parasitic nematode Brugia malayi
- Antibacterial activity of silver nanoparticles of different particle size against Vibrio Natriegens
- Genetic variations associated with response to dutasteride in the treatment of male subjects with androgenetic alopecia
- To eat or not to eat: Reward delay impulsivity in children with loss of control eating, attention deficit / hyperactivity disorder, a double diagnosis, and healthy children
- Factors associated with newborn care knowledge and practices in the upper Himalayas
- Correction: A more physiological approach to lipid metabolism alterations in cancer: CRC-like organoids assessment
- Correlates of concurrent partnerships and patterns of condom use among men who have sex with men and transgender women in Peru
- Ocular and systemic risk factors associated with recurrent disc hemorrhage in primary open-angle glaucoma
- Development of a denoising convolutional neural network-based algorithm for metal artifact reduction in digital tomosynthesis for arthroplasty: A phantom study
- Low-level sensory processes play a more crucial role than high-level cognitive ones in the size-weight illusion
- The prevalence of asthma and allergic rhinitis in Nigeria: A nationwide survey among children, adolescents and adults
- Retraction: Human Cystathionine-β-Synthase Phosphorylation on Serine227 Modulates Hydrogen Sulfide Production in Human Urothelium
- Which clinical and biochemical predictors should be used to screen for diabetes in patients with serious mental illness receiving antipsychotic medication? A large observational study
- Characteristics of diabetic macular edema patients refractory to anti-VEGF treatments and a dexamethasone implant
- Correction: Effects of dietary n-6: n-3 polyunsaturated fatty acid ratios on meat quality, carcass characteristics, tissue fatty acid profiles, and expression of lipogenic genes in growing goats
- Speckle tracking derived reference values of myocardial deformation and impact of cardiovascular risk factors – Results from the population-based STAAB cohort study
- Impact of pterygium on the ocular surface and meibomian glands
- Lack of association between hypothyroxinemia of prematurity and transient thyroid abnormalities with adverse long term neurodevelopmental outcome in very low birth weight infants
- Transcriptome divergence during leaf development in two contrasting switchgrass (Panicum virgatum L.) cultivars
- Study on Dalfampridine in the treatment of Multiple Sclerosis Mobility Disability: A meta-analysis
- Circulating progenitor cells and the expression of Cxcl12, Cxcr4 and angiopoietin-like 4 during wound healing in the murine ear
- EUSKOR: End-to-end coreference resolution system for Basque
- Inactivating pathogenic bacteria in greywater by biosynthesized Cu/Zn nanoparticles from secondary metabolite of Aspergillus iizukae; optimization, mechanism and techno economic analysis
- Exopolysaccharide producing rhizobacteria and their impact on growth and drought tolerance of wheat grown under rainfed conditions
- Structural equation modeling for hypertension and type 2 diabetes based on multiple SNPs and multiple phenotypes
- Correction: Association between ultraviolet radiation exposure dose and cataract in Han people living in China and Taiwan: A cross-sectional study
- Short-term exercise training improves cardiac function associated to a better antioxidant response and lower type 3 iodothyronine deiodinase activity after myocardial infarction
- Unexpected low genetic variation in the South American hystricognath rodent Lagostomus maximus (Rodentia: Chinchillidae)
- PRC2 activates interferon-stimulated genes indirectly by repressing miRNAs in glioblastoma
- Surgical resection is sufficient for incidentally discovered solitary pulmonary nodule caused by nontuberculous mycobacteria in asymptomatic patients
- “I do all I can but I still fail them”: Health system barriers to providing Option B+ to pregnant and lactating women in Malawi
- Impact of major illnesses and geographic regions on do-not-resuscitate rate and its potential cost savings in Taiwan
- Implementation of intermittent theta burst stimulation compared to conventional repetitive transcranial magnetic stimulation in patients with treatment resistant depression: A cost analysis
- Genome-wide analysis of DNA methylation profile identifies differentially methylated loci associated with human intervertebral disc degeneration
- Correction: Artificial neural networks reveal individual differences in metacognitive monitoring of memory
- Combining fish and environmental PCR for diagnostics of diseased laboratory zebrafish in recirculating systems
- Reading skill modulates the effect of parafoveal distractors on foveal lexical decision in deaf students
- Association between the posterior part of the circle of Willis and the vertebral artery hypoplasia
- Exposure to marital conflict: Gender differences in internalizing and externalizing problems among children
- Ethanol locks for the prevention of catheter-related infection in patients with central venous catheter: A systematic review and meta-analysis of randomized controlled trials
- The effect of age and perturbation time on online control during rapid pointing
- Oilseed rape (Brassica napus) resistance to growth of Leptosphaeria maculans in leaves of young plants contributes to quantitative resistance in stems of adult plants
- Lymphocyte proliferation induced by high-affinity peptides for HLA-B*51:01 in Behçet’s uveitis
- Sensitization of avian pathogenic Escherichia coli to amoxicillin in vitro and in vivo in the presence of surfactin
- Genomic characterization of the complete terpene synthase gene family from Cannabis sativa
- Inhibition of gap junctional intercellular communication by an anti-migraine agent, flunarizine
- Levels of serum eosinophil cationic protein are associated with hookworm infection and intensity in endemic communities in Ghana
- Plant growth promoting rhizobacterium Stenotrophomonas maltophilia BJ01 augments endurance against N2 starvation by modulating physiology and biochemical activities of Arachis hypogea
- Hierarchical integrated and segregated processing in the functional brain default mode network within attention-deficit/hyperactivity disorder
- Rising co-payments coincide with unwanted effects on continuity of healthcare for patients with schizophrenia in the Netherlands
- Analysis of Zobellella denitrificans ZD1 draft genome: Genes and gene clusters responsible for high polyhydroxybutyrate (PHB) production from glycerol under saline conditions and its CRISPR-Cas system
- False-negative errors in next-generation sequencing contribute substantially to inconsistency of mutation databases
- Identification of potassium phosphite responsive miRNAs and their targets in potato
- Quantification of bell-shaped size selectivity in shrimp trawl fisheries using square mesh panels and a sorting cone after a Nordmøre grid
- Deactivation of somatosensory and visual cortices during vestibular stimulation is associated with older age and poorer balance
- Combined immunization with attenuated live influenza vaccine and chimeric pneumococcal recombinant protein improves the outcome of virus-bacterial infection in mice
- Flooding performance evaluation of alkyl aryl sulfonate in various alkaline environments
- An artificial intelligent diagnostic system on mobile Android terminals for cholelithiasis by lightweight convolutional neural network
- Enhanced detection of prion infectivity from blood by preanalytical enrichment with peptoid-conjugated beads
- COI metabarcoding primer choice affects richness and recovery of indicator taxa in freshwater systems
- Retraction: APRIL Induces Tumorigenesis and Metastasis of Colorectal Cancer Cells via Activation of the PI3K/Akt Pathway
- The intake pattern and feed preference of layer hens selected for high or low feed conversion ratio
- Individualized pattern recognition for detecting mind wandering from EEG during live lectures
- Ontogenetic expression of thyroid hormone signaling genes: An in vitro and in vivo species comparison
- Post-activation potentiation effect of eccentric overload and traditional weightlifting exercise on jumping and sprinting performance in male athletes
- Effectiveness of different central venous catheter fixation suture techniques: An in vitro crossover study
- Quantitative detection of ALK fusion breakpoints in plasma cell-free DNA from patients with non-small cell lung cancer using PCR-based target sequencing with a tiling primer set and two-step mapping/alignment
- Nuclei deformation reveals pressure distributions in 3D cell clusters
- Strategies for increasing diagnostic yield of community-onset bacteraemia within the emergency department: A retrospective study
- Rapid evolution of Mexican H7N3 highly pathogenic avian influenza viruses in poultry
- Certified service dogs – A cost-effectiveness analysis appraisal
- Endothelial dysfunction and low-grade inflammation in the transition to renal replacement therapy
- Assessing the impact of a research funder’s recommendation to consider core outcome sets
- Validity of six consumer-level activity monitors for measuring steps in patients with chronic heart failure
- Detection of deceptive motions in rugby from visual motion cues
- The impact of antenatal care on neonatal mortality in sub-Saharan Africa: A systematic review and meta-analysis
- Epidemiological investigation and management of bloody diarrhea among children in India
- Irisin promotes C2C12 myoblast proliferation via ERK-dependent CCL7 upregulation
- Bacteria isolated from Bengal cat (Felis catus × Prionailurus bengalensis) anal sac secretions produce volatile compounds potentially associated with animal signaling
- Petri net–based model of the human DNA base excision repair pathway
- Complexation and conformation of lead ion with poly-γ-glutamic acid in soluble state
- The effects of sympathetic activity induced by ice water on blood flow and brachial artery flow-mediated dilatation response in healthy volunteers
- The Youth-Physical Activity Towards Health (Y-PATH) intervention: Results of a 24 month cluster randomised controlled trial
- The COPD multi-dimensional phenotype: A new classification from the STORICO Italian observational study
- Morphological identification of Amphitetranychus species (Acari: Tetranychidae) with crossbreeding, esterase zymograms and DNA barcode data
- Maintaining hope after a disabling stroke: A longitudinal qualitative study of patients’ experiences, views, information needs and approaches towards making treatment decisions
- Cultural differences in the use of acoustic cues for musical emotion experience
- Effects of a rifampicin pre-treatment on linezolid pharmacokinetics
- High prevalence of multidrug resistant Enterobacteriaceae among residents of long term care facilities in Amsterdam, the Netherlands
- Infection/inflammation-associated preterm delivery within 14 days of presentation with symptoms of preterm labour: A multivariate predictive model
- Prognostic value of preoperative hydronephrosis in patients with bladder cancer undergoing radical cystectomy: A meta-analysis
- Correction: Early life predictors of midlife allostatic load: A prospective cohort study
- PCR-free whole exome sequencing: Cost-effective and efficient in detecting rare mutations
- Epstein-Barr virus genome packaging factors accumulate in BMRF1-cores within viral replication compartments
- Symbiotic incompatibility between soybean and Bradyrhizobium arises from one amino acid determinant in soybean Rj2 protein
- Does anticoagulation needed for distally located incidental pulmonary thromboembolism in patients with active cancer?
- Control of human testis-specific gene expression
- Speaking up culture of medical students within an academic teaching hospital: Need of faculty working in patient safety
- Appraisal on the wound healing potential of Melaleuca alternifolia and Rosmarinus officinalis L. essential oil-loaded chitosan topical preparations
- Understanding parental perspectives on outcomes following paediatric encephalitis: A qualitative study
- Results of scoping review do not support mild traumatic brain injury being associated with a high incidence of chronic cognitive impairment: Commentary on McInnes et al. 2017
- Native seed, soil and atmosphere respond to boreal forest topsoil (LFH) storage
- Development of a quantitative polymerase chain reaction assay and environmental DNA sampling methods for Giant Gartersnake (Thamnophis gigas)
- Genetic diversity and population structure of four Chinese rabbit breeds
- Knowledge, attitude and behaviors towards patients with mental illness: Results from a national Lebanese study
- Correction: An impact evaluation of two rounds of mass drug administration on the prevalence of active trachoma: A clustered cross sectional survey
- Comparative prognostic accuracy of sepsis scores for hospital mortality in adults with suspected infection in non-ICU and ICU at an academic public hospital
- Graph convolutional network approach applied to predict hourly bike-sharing demands considering spatial, temporal, and global effects
- Impact of traffic variability on geographic accessibility to 24/7 emergency healthcare for the urban poor: A GIS study in Dhaka, Bangladesh
- Feeling the heat: Elevated temperature affects male display activity of a lekking grassland bird
- Constructing a comprehensive disaster resilience index: The case of Italy
- Intraocular pressure according to different types of tonometry (non-contact and Goldmann applanation) in patients with different degrees of bilateral tearing
- Prevalent vertebral fracture is dominantly associated with spinal microstructural deterioration rather than bone mineral density in patients with type 2 diabetes mellitus
- Silent volumetric multi-contrast 7 Tesla MRI of ocular tumors using Zero Echo Time imaging
- Nonverbal synchrony in virtual reality
- Do speed cameras reduce road traffic collisions?
- A zero-shot learning approach to the development of brain-computer interfaces for image retrieval
- Use of non-HIV medication among people living with HIV and receiving antiretroviral treatment in Côte d’Ivoire, West Africa: A cross-sectional study
- DNA barcoding of southern African crustaceans reveals a mix of invasive species and potential cryptic diversity
- Development of an international external quality assurance program for HIV-1 incidence using the Limiting Antigen Avidity assay
- Correction: The mean cell volume difference (dMCV) reflects serum hypertonicity in diabetic dogs
- Structural characteristics of lipocalin allergens: Crystal structure of the immunogenic dog allergen Can f 6
- Transport oil product consumption and GHG emission reduction potential in China: An electric vehicle-based scenario analysis
- Ontogenetic shift in the energy allocation strategy and physiological condition of larval plaice (Pleuronectes platessa)
- Increased proliferation and altered cell cycle regulation in pancreatic stem cells derived from patients with congenital hyperinsulinism
- Diagnostic accuracy of Xpert MTB/RIF assay and non-molecular methods for the diagnosis of tuberculosis lymphadenitis
- Assessment of glucose-6-phosphate dehydrogenase activity using CareStart G6PD rapid diagnostic test and associated genetic variants in Plasmodium vivax malaria endemic setting in Mauritania
- Spatial distribution of breast cancer in Sudan 2010-2016
- Human-induced fire regime shifts during 19th century industrialization: A robust fire regime reconstruction using northern Polish lake sediments
- Enhanced effectiveness of oil dispersants in destabilizing water-in-oil emulsions
- Development of UV spectrophotometry methods for concurrent quantification of amlodipine and celecoxib by manipulation of ratio spectra in pure and pharmaceutical formulation
- Iron and manganese co-limit growth of the Southern Ocean diatom Chaetoceros debilis
- Bilateral and unilateral load-velocity profiling in a machine-based, single-joint, lower body exercise
- Veterans Health Administration nurses’ training and beliefs related to care of patients with traumatic brain injury
- Supplementation strategies affect the feed intake and performance of grazing replacement heifers
- Active transcutaneous bone conduction hearing implants: Systematic review and meta-analysis
- Parameterization-induced uncertainties and impacts of crop management harmonization in a global gridded crop model ensemble
- Acidification effects on isolation of extracellular vesicles from bovine milk
- GPR40 full agonism exerts feeding suppression and weight loss through afferent vagal nerve
- Mining version history to predict the class instability
- Humpback whale song occurrence reflects ecosystem variability in feeding and migratory habitat of the northeast Pacific
- A phase 2 study of an oral mTORC1/mTORC2 kinase inhibitor (CC-223) for non-pancreatic neuroendocrine tumors with or without carcinoid symptoms
- Asprosin response in hypoglycemia is not related to hypoglycemia unawareness but rather to insulin resistance in type 1 diabetes
- Muscle oxygenation maintained during repeated-sprints despite inspiratory muscle loading
- Reconstructing systematic persistent impacts of promotional marketing with empirical nonlinear dynamics
- Trans-national conservation and infrastructure development in the Heart of Borneo
- Prediction of cardiovascular disease risk among people with severe mental illness: A cohort study
- Data in question: A survey of European biobank professionals on ethical, legal and societal challenges of biobank research
- Hypertensive APOL1 risk allele carriers demonstrate greater blood pressure reduction with angiotensin receptor blockade compared to low risk carriers
- Reconstructing birth in Australopithecus sediba
- Value of contrast-enhanced ultrasound for preoperative assessment of liver reserve function in patients with liver tumors
- Correction: Identifying obesity/overweight status in children and adolescents; A cross-sectional medical record review of physicians’ weight screening practice in outpatient clinics, Saudi Arabia
- Incidence and risk factors of loss to follow-up among HIV-infected children in an antiretroviral treatment program
- Changes in intracellular folate metabolism during high-dose methotrexate and Leucovorin rescue therapy in children with acute lymphoblastic leukemia
- Functional role and evolutionary contributions of floral gland morphoanatomy in the Paleotropical genus Acridocarpus (Malpighiaceae)
- On the efficiency of HIV transmission: Insights through discrete time HIV models
- Metabolic cost calculations of gait using musculoskeletal energy models, a comparison study
- Comparison of molecular profile in triple-negative inflammatory and non-inflammatory breast cancer not of mesenchymal stem-like subtype
- Evolutionary analysis of six chloroplast genomes from three Persea americana ecological races: Insights into sequence divergences and phylogenetic relationships
- Cultural transmission in a food preparation task: The role of interactivity, innovation and storytelling
- Correction: Effects of affective priming through music on the use of emotion words
- Safety and immunogenicity of investigational seasonal influenza hemagglutinin DNA vaccine followed by trivalent inactivated vaccine administered intradermally or intramuscularly in healthy adults: An open-label randomized phase 1 clinical trial
- Estimation of vaccination coverage from electronic healthcare records; methods performance evaluation – A contribution of the ADVANCE-project
- Dietary phytogenics and galactomannan oligosaccharides in low fish meal and fish oil-based diets for European sea bass (Dicentrarchus labrax) juveniles: Effects on gut health and implications on in vivo gut bacterial translocation
- Suicide by hanging: Results from a national survey in Switzerland and its implications for suicide prevention
- Gene dysregulation in peripheral blood of moyamoya disease and comparison with other vascular disorders
- Genome wide genetic dissection of wheat quality and yield related traits and their relationship with grain shape and size traits in an elite × non-adapted bread wheat cross
- Safety and tolerability of artesunate-amodiaquine, artemether-lumefantrine and quinine plus clindamycin in the treatment of uncomplicated Plasmodium falciparum malaria in Kinshasa, the Democratic Republic of the Congo
- Factors influencing the admission decision for Medical Psychiatry Units: A concept mapping approach
- Comparison of post-traumatic changes in circulating and bone marrow leukocytes between BALB/c and CD-1 mouse strains
- Physiological stress reactivity and recovery related to behavioral traits in dogs (Canis familiaris)
- Associations between birth order with mental wellbeing and psychological distress in midlife: Findings from the 1970 British Cohort Study (BCS70)
- Non-steroidal anti-inflammatory drugs use in older adults decreases risk of Alzheimer’s disease mortality
- The cost-effectiveness of neonatal versus prenatal screening for congenital toxoplasmosis
- Ancient technology and punctuated change: Detecting the emergence of the Edomite Kingdom in the Southern Levant
- Flowers as viral hot spots: Honey bees (Apis mellifera) unevenly deposit viruses across plant species
- Randomized control trial of Tools of the Mind: Marked benefits to kindergarten children and their teachers
- Preserving cultural heritage: Analyzing the antifungal potential of ionic liquids tested in paper restoration
- PNPLA3 rs738409 G allele carriers with genotype 1b HCV cirrhosis have lower viral load but develop liver failure at younger age
- Correction: Unraveling the genetic complexity underlying sorghum response to water availability
- Impact of tear metrics on the reliability of perimetry in patients with dry eye
- Using DNA barcoding to improve invasive pest identification at U.S. ports-of-entry
- Correction: Effects of Lactobacillus plantarum 15-1 and fructooligosaccharides on the response of broilers to pathogenic Escherichia coli O78 challenge
- Physico-chemical characterization and transcriptome analysis of 5-methyltryptophan resistant lines in rice
- Patient factors affecting successful linkage to treatment in a cervical cancer prevention program in Kenya: A prospective cohort study
- Is this a man’s world? The effect of gender diversity and gender equality on firm innovativeness
- Procalcitonin to stop antibiotics after cardiovascular surgery in a pediatric intensive care unit—The PROSACAB study
- Temporal trends, predictors, and outcomes of acute kidney injury and hemodialysis use in acute myocardial infarction-related cardiogenic shock
- Quantitation of free glycation compounds in saliva
- Resolving an 87-year-old taxonomical curiosity with the description of Psylla frodobagginsi sp. nov. (Hemiptera: Sternorrhyncha: Psyllidae), a second distinct Psylla species on the New Zealand endemic plant kōwhai
- The effect of cathodal tDCS on fear extinction: A cross-measures study
- Physiological responses to affiliation during conversation: Comparing neurotypical males and males with Asperger syndrome
- Human cord blood (hCB)-CD34+ humanized mice fail to reject human acute myeloid leukemia cells
- Investigating the dispersal of antibiotic resistance associated genes from manure application to soil and drainage waters in simulated agricultural farmland systems
- Continuous norming of psychometric tests: A simulation study of parametric and semi-parametric approaches
- Phylogenetic microbiota profiling in fecal samples depends on combination of sequencing depth and choice of NGS analysis method
- Cost-effectiveness of apixaban compared to other anticoagulants in patients with atrial fibrillation in the real-world and trial settings
- Biochemical profile and in vitro biological activities of extracts from seven folk medicinal plants growing wild in southern Tunisia
- Low genetic differentiation yet high phenotypic variation in the invasive populations of Spartina alterniflora in Guangxi, China
- A mathematical model for designing networks of C-Reactive Protein point of care testing
- Prevalence of hypochondriac symptoms among health science students in China: A systematic review and meta-analysis
- Femtosecond laser induced step-like structures inside transparent hydrogel due to laser induced threshold reduction
- From In Situ to satellite observations of pelagic Sargassum distribution and aggregation in the Tropical North Atlantic Ocean
- The polyether ionophore salinomycin targets multiple cellular pathways to block proliferative vitreoretinopathy pathology
- BRAF V600E and Pten deletion in mice produces a histiocytic disorder with features of Langerhans cell histiocytosis
- HIV prevalence and risk behavior among male and female adults screened for enrolment into a vaccine preparedness study in Maputo, Mozambique
- Sputum microbiota and inflammation at stable state and during exacerbations in a cohort of chronic obstructive pulmonary disease (COPD) patients
- Direct estimation of the parameters of a delayed, intermittent activation feedback model of postural sway during quiet standing
- Occurrence mechanism and coping paths of accidents of highly aggregated tourist crowds based on system dynamics
- Correction: Low Dose Aerosol Fitness at the Innate Phase of Murine Infection Better Predicts Virulence amongst Clinical Strains of Mycobacterium tuberculosis
- Effects of enalapril and paricalcitol treatment on diabetic nephropathy and renal expressions of TNF-α, p53, caspase-3 and Bcl-2 in STZ-induced diabetic rats
- Correction: Public reaction to Chikungunya outbreaks in Italy—Insights from an extensive novel data streams-based structural equation modeling analysis
- Correction: Comparison of neurodegenerative types using different brain MRI analysis metrics in older adults with normal cognition, mild cognitive impairment, and Alzheimer’s dementia
- Intra-individual variability of sleep and nocturnal cardiac autonomic activity in elite female soccer players during an international tournament
- Therapeutic efficacy of equine botulism heptavalent antitoxin against all seven botulinum neurotoxins in symptomatic guinea pigs
- Interleukin 10 knock-down in bovine monocyte-derived macrophages has distinct effects during infection with two divergent strains of Mycobacterium bovis
- Clinical outcomes of bortezomib-based therapy in Taiwanese patients with multiple myeloma: A nationwide population-based study and a single-institute analysis
- Scope and efficacy of the broad-spectrum topical antiseptic choline geranate
- Hematological and biochemical parameters for Chinese rhesus macaque
- Veterinary peer study groups as a method of continuous education—A new approach to identify and address factors associated with antimicrobial prescribing
- Correction: The prognosis of heart failure patients: Does sodium level play a significant role?
- Maternal malaria but not schistosomiasis is associated with a higher risk of febrile infection in infant during the first 3 months of life: A mother-child cohort in Benin
- Systematic identification of facility-based stillbirths and neonatal deaths through the piloted use of an adapted RAPID tool in Liberia and Nepal
- Effects of salbutamol and phlorizin on acute pulmonary inflammation and disease severity in experimental sepsis
- Correction: Age, sex and storage time influence hair cortisol levels in a wild mammal population
- Reasons to care: Personal motivation as a key factor in the practice of the professional foster carer in Romania
- Determinants of clinical, functional and personal recovery for people with schizophrenia and other severe mental illnesses: A cross-sectional analysis
- Continuity of care for TB patients at a South African hospital: A qualitative participatory study of the experiences of hospital staff
- EGF receptor stimulation shifts breast cancer cell glucose metabolism toward glycolytic flux through PI3 kinase signaling
- The Better Management of Patients with Osteoarthritis Program: Outcomes after evidence-based education and exercise delivered nationwide in Sweden
- The negative effects of short-term extreme thermal events on the seagrass Posidonia oceanica are exacerbated by ammonium additions
- Pathogen invasion history elucidates contemporary host pathogen dynamics
- Chinese herbal formulae for the treatment of menopausal hot flushes: A systematic review and meta-analysis
- Healthcare resource utilization and costs for multiple sclerosis management in the Campania region of Italy: Comparison between centre-based and local service healthcare delivery
- Deconstruction of central line insertion guidelines based on the positive deviance approach—Reducing gaps between guidelines and implementation: A qualitative ethnographic research
- PBMCs transcriptome profiles identified breed-specific transcriptome signatures for PRRSV vaccination in German Landrace and Pietrain pigs
- The impact of admission serum lactate on children with moderate to severe traumatic brain injury
- Hypervirulent Klebsiella pneumoniae serotype K1 clinical isolates form robust biofilms at the air-liquid interface
- Determination of the bruise degree for cherry using Vis-NIR reflection spectroscopy coupled with multivariate analysis
- Genome-wide identification and expression profile analysis of nuclear factor Y family genes in Sorghum bicolor L. (Moench)
- Trends in maternal prepregnancy body mass index (BMI) and its association with birth and maternal outcomes in California, 2007–2016: A retrospective cohort study
- Distribution of the Duffy genotypes in Malaysian Borneo and its relation to Plasmodium knowlesi malaria susceptibility
- Hippocampal connectivity with sensorimotor cortex during volitional finger movements: Laterality and relationship to motor learning
- A self-adaptive deep learning method for automated eye laterality detection based on color fundus photography
- The effect of child marriage on the utilization of maternal health care in Nepal: A cross-sectional analysis of Demographic and Health Survey 2016
- Identification of QTLs for powdery mildew (Podosphaera aphanis; syn. Sphaerotheca macularis f. sp. fragariae) susceptibility in cultivated strawberry (Fragaria ×ananassa)
- Chemical volatiles present in cotton gin trash: A by-product of cotton processing
- PTP1B negatively regulates nitric oxide-mediated Pseudomonas aeruginosa killing by neutrophils
- Differential metabolomics networks analysis of menopausal status
- Experimental study of the temporal profile of breath alcohol concentration in a Chinese population after a light meal
- Association between regional brain volumes and BMI z-score change over one year in children
- Relationships between Potentially Toxic Elements in intertidal sediments and their bioaccumulation by benthic invertebrates
- Long-term outcomes of dialysis in patients with chronic kidney disease and new-onset atrial fibrillation: A population-based cohort study
- Hospital burden of pulmonary arterial hypertension in France
- Understanding the variability of Australian fire weather between 1973 and 2017
- Photon-counting cine-cardiac CT in the mouse
- Ecophysiological impacts of Esca, a devastating grapevine trunk disease, on Vitis vinifera L.
- Black “Reading the Mind in the Eyes” task: The development of a task assessing mentalizing from black faces
- Osmolytes ameliorate the effects of stress in the absence of the heat shock protein Hsp104 in Saccharomyces cerevisiae
- Reliable and robust method for abdominal muscle mass quantification using CT/MRI: An explorative study in healthy subjects
- Validation of the Rainbow Model of Integrated Care Measurement Tools (RMIC-MTs) in renal care for patient and care providers
- Multiple origins and the population genetic structure of Rubus takesimensis (Rosaceae) on Ulleung Island: Implications for the genetic consequences of anagenetic speciation
- Genetic profiling of fatty acid desaturase polymorphisms identifies patients who may benefit from high-dose omega-3 fatty acids in cardiac remodeling after acute myocardial infarction—Post-hoc analysis from the OMEGA-REMODEL randomized controlled trial
- A randomized controlled trial examining the efficacy of an internet-based cognitive behavioral therapy program for adolescents with anxiety disorders
- Optimising outputs from a validated online instrument to measure health-related quality of life (HRQL) in dogs
- Young adults’ perceptions of using wearables, social media and other technologies to detect worsening mental health: A qualitative study
- Characteristics of prescription in 29 Level 3 Neonatal Wards over a 2-year period (2017-2018). An inventory for future research
- Genetic characterization of fall armyworm (Spodoptera frugiperda) in Ecuador and comparisons with regional populations identify likely migratory relationships
- Correction: Lkb1 Deficiency Alters Goblet and Paneth Cell Differentiation in the Small Intestine
- Cardiac resynchronization therapy-heart failure (CRT-HF) clinic: A novel model of care
- Synteny and phylogenetic analysis of paralogous thyrostimulin beta subunits (GpB5) in vertebrates
- Dual-Subpopulation as reciprocal optional external archives for differential evolution
- NGS analysis in Marfan syndrome spectrum: Combination of rare and common genetic variants to improve genotype-phenotype correlation analysis
- Optimization of cataract surgery follow-up: A standard set of questions can predict unexpected management changes at postoperative week one
- Silymarin in non-cirrhotics with non-alcoholic steatohepatitis: A randomized, double-blind, placebo controlled trial
- Clinical evaluation of General Electric new Swiftscan solution in bone scintigraphy on NaI-camera: A head to head comparison with Siemens Symbia
- Pharmacist-led academic detailing improves statin therapy prescribing for Malaysian patients with type 2 diabetes: Quasi-experimental design
- Proton pump inhibitors attenuate myofibroblast formation associated with thyroid eye disease through the aryl hydrocarbon receptor
- Clinical outcomes with neoadjuvant versus adjuvant chemotherapy for triple negative breast cancer: A report from the National Cancer Database
- Identification and characterization of a novel heparan sulfate-binding domain in Activin A longest variants and implications for function
- Wikipedia network analysis of cancer interactions and world influence
- Using path signatures to predict a diagnosis of Alzheimer’s disease
- Development and verification of prediction models for preventing cardiovascular diseases
- Additive and heterozygous (dis)advantage GWAS models reveal candidate genes involved in the genotypic variation of maize hybrids to Azospirillum brasilense
- Fish tank granuloma: An emerging skin disease in Iran mimicking Cutaneous Leishmaniasis
- Transience effect in capture-recapture studies: The importance of its biological meaning
- Detailed global modelling of soil organic carbon in cropland, grassland and forest soils
- Oral dosing for antenatal corticosteroids in the Rhesus macaque
- Retraction: Modulation of the Pentose Phosphate Pathway Induces Endodermal Differentiation in Embryonic Stem Cells
- An analysis on HBsAg, Anti-HCV, Anti-HIV½ and VDRL test results in blood donors according to gender, age range and years
- Clinical factors associated with bacterial translocation in Japanese patients with type 2 diabetes: A retrospective study
- Meaningful work and resilience among teachers: The mediating role of work engagement and job crafting
- The conditional Fama-French model and endogenous illiquidity: A robust instrumental variables test
- Breast cancers utilize hypoxic glycogen stores via PYGB, the brain isoform of glycogen phosphorylase, to promote metastatic phenotypes
- Characterization of sequentially-staged cancer cells using electrorotation
- Vancomycin-laden calcium phosphate-calcium sulfate composite allows bone formation in a rat infection model
- Genetic evidence for plural introduction pathways of the invasive weed Paterson’s curse (Echium plantagineum L.) to southern Australia
- Risk of major autoimmune diseases in female breast cancer patients: A nationwide, population-based cohort study
- Real-time three-dimensional MRI for the assessment of dynamic carpal instability
- Interim report on the effective intraperitoneal therapy of insulin-dependent diabetes mellitus in pet dogs using “Neo-Islets,” aggregates of adipose stem and pancreatic islet cells (INAD 012-776)
- The frequency of bowel and bladder problems in multiple sclerosis and its relation to fatigue: A single centre experience
- Retraction: Analysis of Mycobacterium tuberculosis-Specific CD8 T-Cells in Patients with Active Tuberculosis and in Individuals with Latent Infection
- The association between role model presence and self-regulation in early adolescence: A cross-sectional study
- Correction: A controlled-release oral opioid supports S. aureus survival in injection drug preparation equipment and may increase bacteremia and endocarditis risk
- Methamphetamine regulation of activity and topology of ventral midbrain networks
- Evaluation and treatment of latent tuberculosis infection among healthcare workers in Korea: A multicentre cohort analysis
- Occult periprosthetic femoral fractures occur frequently during a long, trapezoidal, double-tapered cementless femoral stem fixation in primary THA
- TCF4 induces enzalutamide resistance via neuroendocrine differentiation in prostate cancer
- Structural characterization of EGFR exon 19 deletion mutation using molecular dynamics simulation
- Comparing infiltration rates in soils managed with conventional and alternative farming methods: A meta-analysis
- Correction: Permissivity of Primary Human Hepatocytes and Different Hepatoma Cell Lines to Cell Culture Adapted Hepatitis C Virus
- Radiomics features of the primary tumor fail to improve prediction of overall survival in large cohorts of CT- and PET-imaged head and neck cancer patients
- The complete mitochondrial genome of Calyptogena marissinica (Heterodonta: Veneroida: Vesicomyidae): Insight into the deep-sea adaptive evolution of vesicomyids
- Correction: In vitro larval rearing protocol for the stingless bee species Melipona scutellaris for toxicological studies
- Correction: Morphological and molecular identification of the dioecious “African species Volvox rousseletii (Chlorophyceae) in the water column of a Japanese lake based on field-collected and cultured materials
- Upper versus lower airway microbiome and metagenome in children with cystic fibrosis and their correlation with lung inflammation
- “…or else I close my ears” How women with obesity want to be approached and treated regarding gestational weight management: A qualitative interview study
- Does a spinal implant alter dual energy X-ray absorptiometry body composition measurements?
- Economic and livestock health impacts of birds on dairies: Evidence from a survey of Washington dairy operators
- Repair of subtotal tympanic membrane perforations: A temporal bone study of several tympanoplasty materials
- Shifts in temperature influence how Batrachochytrium dendrobatidis infects amphibian larvae
- Sequential two-step chromatographic purification of infectious poliovirus using ceramic fluoroapatite and ceramic hydroxyapatite columns
- Frequency and distribution of corneal astigmatism and keratometry features in adult life: Methodology and findings of the UK Biobank study
- Differences in the impedance of cochlear implant devices within 24 hours of their implantation
- Suppressive impact of metronomic chemotherapy using UFT and/or cyclophosphamide on mediators of breast cancer dissemination and invasion
- Expression of Concern: miRNA 17 Family Regulates Cisplatin-Resistant and Metastasis by Targeting TGFbetaR2 in NSCLC
- Group leaders establish cooperative norms that persist in subsequent interactions
- Addis Ababa population-based pattern of cancer therapy, Ethiopia
- Agreement between the Cochrane risk of bias tool and Physiotherapy Evidence Database (PEDro) scale: A meta-epidemiological study of randomized controlled trials of physical therapy interventions
- Oxidoreductase disulfide bond proteins DsbA and DsbB form an active redox pair in Chlamydia trachomatis, a bacterium with disulfide dependent infection and development
- DNA barcoding of coastal ray-finned fishes in Vietnam
- Comparison of climbing-specific strength and endurance between lead and boulder climbers
- The performance of different case definitions for severe influenza surveillance among HIV-infected and HIV-uninfected children aged <5 years in South Africa, 2011–2015
- Analgesic drug use in elderly persons: A population-based study in Southern Italy
- RCER: Reliable Cluster-based Energy-aware Routing protocol for heterogeneous Wireless Sensor Networks
- Beta-defensins and analogs in Helicobacter pylori infections: mRNA expression levels, DNA methylation, and antibacterial activity
- Changing educational gradient in long-term care-free life expectancy among German men, 1997-2012
- A non-parametric significance test to compare corpora
- Evaluating the impact of policies recommending PrEP to subpopulations of men and transgender women who have sex with men based on demographic and behavioral risk factors
- Different levels of statistical learning - Hidden potentials of sequence learning tasks
- Dry period heat stress induces microstructural changes in the lactating mammary gland
- Organic resolution function and effects of platinum nanoparticles on bacteria and organic matter
- High levels of fasting glucose and glycosylated hemoglobin values are associated with hyperfiltration in a Spanish prediabetes cohort. The PREDAPS Study
- Genetically distinct Group B Streptococcus strains induce varying macrophage cytokine responses
- Dynamic up- and down-regulation of the default (DMN) and extrinsic (EMN) mode networks during alternating task-on and task-off periods
- ERK1/ATF-2 signaling axis contributes to interleukin-1β-induced MMP-3 expression in dermal fibroblasts
- Cytokine profiles of umbilical cord blood mononuclear cells upon in vitro stimulation with lipopolysaccharides of different vaginal gram-negative bacteria
- Everolimus in de novo kidney transplant recipients participating in the Eurotransplant senior program: Results of a prospective randomized multicenter study (SENATOR)
- Lipopolysaccharide induces mouse translocator protein (18 kDa) expression via the AP-1 complex in the microglial cell line, BV-2
- Does effectiveness in performance appraisal improve with rater training?
- National trends in inpatient endometriosis admissions: Patients, procedures and outcomes, 2006−2015
- Affective and enjoyment responses to 12 weeks of high intensity interval training and moderate continuous training in adults with Crohn’s disease
- Thrombophilic risk factors in hemodialysis: Association with early vascular access occlusion and patient survival in long-term follow-up
- Cabbage stem flea beetle’s (Psylliodes chrysocephala L.) susceptibility to pyrethroids and tolerance to thiacloprid in the Czech Republic
- Implicit learning of artificial grammatical structures after inferior frontal cortex lesions
- Potential survival benefits from optimized chemotherapy implementation in advanced ovarian cancer: Projections from a microsimulation model
- Predictors of SLE relapse in pregnancy and post-partum among multi-ethnic patients in Malaysia
- Heat stress responses in a large set of winter wheat cultivars (Triticum aestivum L.) depend on the timing and duration of stress
- Mice deficient in NKLAM have attenuated inflammatory cytokine production in a Sendai virus pneumonia model
- Dysregulation of microRNAs and target genes networks in human abdominal aortic aneurysm tissues
- Quality of life and associated factors among patients with breast cancer under chemotherapy at Tikur Anbessa specialized hospital, Addis Ababa, Ethiopia
- Evaluation of suitable reference genes in Brassica juncea and its wild relative Camelina sativa for qRT-PCR analysis under various stress conditions
- Time-related immunomodulation by stressors and corticosterone transdermal application in toads
- Machine learning discovery of longitudinal patterns of depression and suicidal ideation
- Multi-scale patterns of tick occupancy and abundance across an agricultural landscape in southern Africa
- A matter of taste: Spatial and ontogenetic variations on the trophic ecology of the tiger shark at the Galapagos Marine Reserve
- Retraction: Adaptive double threshold energy detection based on Markov model for cognitive radio
- Adrenal gland size in obstructive sleep apnea: Morphological assessment of hypothalamic pituitary adrenal axis activity
- Out-of-pocket health spending among Medicare beneficiaries: Which chronic diseases are most costly?
- A large-scale chromosomal inversion is not associated with life history development in rainbow trout from Southeast Alaska
- Deployment, suicide, and overdose among comorbidity phenotypes following mild traumatic brain injury: A retrospective cohort study from the Chronic Effects of Neurotrauma Consortium
- Association between alcohol intake and measures of incident CKD: An analysis of nationwide health screening data
- Exploration of icariin analog structure space reveals key features driving potent inhibition of human phosphodiesterase-5
- A quantitative approach for the analysis of clinician recognition of acute respiratory distress syndrome using electronic health record data
- Morphological, microbiological and ultrastructural aspects of sepsis by Aeromonas hydrophila in Piaractus mesopotamicus
- Recidivism rates in individuals receiving community sentences: A systematic review
- The association of intensive care with utilization and costs of outpatient healthcare services and quality of life
- How well do cancer survivor self-classifications of anxiety, depression and stress agree with a standardised tool? Results of a cross-sectional study
- Comparative nutritional characteristics of the three major Chinese Dendrobium species with different growth years
- Nilotinib, an approved leukemia drug, inhibits smoothened signaling in Hedgehog-dependent medulloblastoma
- Geographic differentiation of agritourism activities in Poland vs. cultural and natural attractiveness of destinations at district level
- Social participation reduces isolation among Japanese older people in urban area: A 3-year longitudinal study
- Explaining age-related decline in theory of mind: Evidence for intact competence but compromised executive function
- Role of GDF15 in methylseleninic acid-mediated inhibition of cell proliferation and induction of apoptosis in prostate cancer cells
- Black people are convicted more for being black than for being poor: The role of social norms and cultural prejudice on biased racial judgments
- Bulked segregant analysis RNA-seq (BSR-Seq) validated a stem resistance locus in Aegilops umbellulata, a wild relative of wheat
- Neurobehavioral dysfunction in non-alcoholic steatohepatitis is associated with hyperammonemia, gut dysbiosis, and metabolic and functional brain regional deficits
- Barriers and enablers to the implementation of a complex quality improvement intervention for acute kidney injury: A qualitative evaluation of stakeholder perceptions of the Tackling AKI study
- Soil and vegetation conditions changes following the different sand dune restoration measures on the Zoige Plateau
- Experimental H1N1pdm09 infection in pigs mimics human seasonal influenza infections
- Emission characteristics of diethylhexyl phthalate (DEHP) from building materials determined using a passive flux sampler and micro-chamber
- Multi-focus microscope with HiLo algorithm for fast 3-D fluorescent imaging
- Pontoscolex corethrurus: A homeless invasive tropical earthworm?
- Modeling reciprocal effects in medical research: Critical discussion on the current practices and potential alternative models
- Does palliative chemotherapy really palliate and are we measuring it correctly? A mixed methods longitudinal study of health related quality of life in advanced soft tissue sarcoma
- Developing cookies formulated with goat cream enriched with conjugated linoleic acid
- The effects of combining focus of attention and autonomy support on shot accuracy in the penalty kick
- Association between hot flashes severity and oxidative stress among Mexican postmenopausal women: A cross-sectional study
- A combined strategy of neuropeptide prediction and tandem mass spectrometry identifies evolutionarily conserved ancient neuropeptides in the sea anemone Nematostella vectensis
- Lipidome profiles of postnatal day 2 vaginal swabs reflect fat composition of gilt’s postnatal diet
- Antitumor activity of a novel dual functional podophyllotoxin derivative involved PI3K/AKT/mTOR pathway
- Genome-wide developed microsatellites reveal a weak population differentiation in the hoverfly Eupeodes corollae (Diptera: Syrphidae) across China
- Prognosis of severe acquired brain injury: Short and long-term outcome determinants and their potential clinical relevance after rehabilitation. A comprehensive approach to analyze cohort studies
- An in silico investigation of menthol metabolism
- Variant analysis pipeline for accurate detection of genomic variants from transcriptome sequencing data
- Identification of candidate flowering and sex genes in white Guinea yam (D. rotundata Poir.) by SuperSAGE transcriptome profiling
- Optimizing the intrinsic parallel diffusivity in NODDI: An extensive empirical evaluation
- The quality of guidelines for diabetic foot ulcers: A critical appraisal using the AGREE II instrument
- Mastitis risk effect on the economic consequences of paratuberculosis control in dairy cattle: A stochastic modeling study
- Confounding by indication of the safety of de-escalation in community-acquired pneumonia: A simulation study embedded in a prospective cohort
- Effects from diet-induced gut microbiota dysbiosis and obesity can be ameliorated by fecal microbiota transplantation: A multiomics approach
- Drivers of HIV-1 transmission: The Portuguese case
- Integration of a FT expression cassette into CRISPR/Cas9 construct enables fast generation and easy identification of transgene-free mutants in Arabidopsis
- A biface production older than 600 ka ago at Notarchirico (Southern Italy) contribution to understanding early Acheulean cognition and skills in Europe
- Mass evacuation and increases in long-term care benefits: Lessons from the Fukushima nuclear disaster
- Circulating levels of free 25(OH)D increase at the onset of rheumatoid arthritis
- The expression of equine keratins K42 and K124 is restricted to the hoof epidermal lamellae of Equus caballus
- Soil respiration from fields under three crop rotation treatments and three straw retention treatments
- Inhibition of polymerase chain reaction: Pathogen-specific controls are better than human gene amplification
- Linkage disequilibrium and haplotype block patterns in popcorn populations
- Downscaling satellite soil moisture using geomorphometry and machine learning
- Choosing efficient actions: Deciding where to walk
- The zooarchaeology and isotopic ecology of the Bahamian hutia (Geocapromys ingrahami): Evidence for pre-Columbian anthropogenic management
- Synergy of the flow behaviour and disperse phase of cellulose nanoparticles in enhancing oil recovery at reservoir condition
- Accuracy of Determine TB-LAM Ag to detect TB in HIV infected patients associated with diagnostic methods used in Brazilian public health units
- Human papillomavirus infection among head and neck squamous cell carcinomas in southern China
- Comparison of feature point detectors for multimodal image registration in plant phenotyping
- Quartet-based inference of cell differentiation trees from ChIP-Seq histone modification data
- Detection and prognostic relevance of circulating tumour cells (CTCs) in Asian breast cancers using a label-free microfluidic platform
- Coralline algal calcification: A morphological and process-based understanding
- Comparing record linkage software programs and algorithms using real-world data
- Antimicrobial resistance and molecular genotyping of Salmonella enterica serovar Enteritidis clinical isolates from Guizhou province of Southwestern China
- Measuring sexual relationship power equity among young women and young men South Africa: Implications for gender-transformative programming
- Effectiveness, safety/tolerability of OBV/PTV/r ± DSV in patients with HCV genotype 1 or 4 with/without HIV-1 co-infection, chronic kidney disease (CKD) stage IIIb-V and dialysis in Spanish clinical practice – Vie-KinD study
- The genome of Alcaligenes aquatilis strain BU33N: Insights into hydrocarbon degradation capacity
- A randomized pilot efficacy and safety trial of diazoxide choline controlled-release in patients with Prader-Willi syndrome
- LMX1A inhibits C-Myc expression through ANGPTL4 to exert tumor suppressive role in gastric cancer
- Lung clearance index to detect the efficacy of Aztreonam lysine inhalation in patients with cystic fibrosis and near normal spirometry – A single-centre feasibility study
- Association of vitamin D nutrition with neuro-developmental outcome of infants of slums in Bangladesh
- Effect of PEPFAR funding policy change on HIV service delivery in a large HIV care and treatment network in Nigeria
- Friends, relatives, sanity, and health: The costs of politics
- European public perceptions of homelessness: A knowledge, attitudes and practices survey
- An overview of the quality assurance programme for HIV rapid testing in South Africa: Outcome of a 2-year phased implementation of quality assurance program
- Transcatheter aortic valve implantation versus surgical aortic valve replacement in patients at low and intermediate risk: A risk specific meta-analysis of randomized controlled trials
- Global smoking trends in inflammatory bowel disease: A systematic review of inception cohorts
- Identification of inflammatory markers suitable for non-invasive, repeated measurement studies in biobehavioral research: A feasibility study
- Genomic analyses reveal an absence of contemporary introgressive admixture between fin whales and blue whales, despite known hybrids
- Tipping the balance towards long-term retention in the HIV care cascade: A mixed methods study in southern Mozambique
- Diagnosis and classification of pediatric acute appendicitis by artificial intelligence methods: An investigator-independent approach
- Stylistic variation on the Donald Trump Twitter account: A linguistic analysis of tweets posted between 2009 and 2018
- Kinematic determinants of scoring success in the fencing flick: Logistic and linear multiple regression analysis
- Preferences for formal and traditional sources of childbirth and postnatal care among women in rural Africa: A systematic review
- Spectral characteristics of urine specimens from healthy human volunteers analyzed using Raman chemometric urinalysis (Rametrix)
- Associations between industry involvement and study characteristics at the time of trial registration in biomedical research
- A review of the elusive bicolored iris Snouted Treefrogs (Anura: Hylidae:Scinax uruguayus group)
- Development of peptide biosensor for the detection of dengue fever biomarker, nonstructural 1
- The predictive performance of SAPS 2 and SAPS 3 in an intermediate care unit for internal medicine at a German university transplant center; A retrospective analysis
- Advancing computational biology and bioinformatics research through open innovation competitions
- Dynamic changes in the physicochemical properties of fresh-cut produce wash water as impacted by commodity type and processing conditions
- Mapping online hate: A scientometric analysis on research trends and hotspots in research on online hate
- Orthogonal projection to latent structures and first derivative for manipulation of PLSR and SVR chemometric models' prediction: A case study
- DNA vaccine based on conserved HA-peptides induces strong immune response and rapidly clears influenza virus infection from vaccinated pigs
- Malaria transmission through the mosquito requires the function of the OMD protein
- Small molecule inhibition of lysine-specific demethylase 1 (LSD1) and histone deacetylase (HDAC) alone and in combination in Ewing sarcoma cell lines
- Governing Tripolye: Integrative architecture in Tripolye settlements
- In vitro selective cytotoxicity of the dietary chalcone cardamonin (CD) on melanoma compared to healthy cells is mediated by apoptosis
- Mortality, perception, and scale: Understanding how predation shapes space use in a wild prey population
- DNA analysis of elasmobranch products originating from Bangladesh reveals unregulated elasmobranch fishery and trade on species of global conservation concern
- Genome-wide analysis of methylation in giant pandas with cataract by methylation-dependent restriction-site associated DNA sequencing (MethylRAD)
- A spherical falling film gas-liquid equilibrator for rapid and continuous measurements of CO2 and other trace gases
- The role of vitamin D in increasing circulating T regulatory cell numbers and modulating T regulatory cell phenotypes in patients with inflammatory disease or in healthy volunteers: A systematic review
- Gastroenteritis and respiratory infection outbreaks in French nursing homes from 2007 to 2018: Morbidity and all-cause lethality according to the individual characteristics of residents
- A pull-down and slot blot-based screening system for inhibitor compounds of the podoplanin-CLEC-2 interaction
- De novo transcriptome analysis of Viola ×wittrockiana exposed to high temperature stress
- Robust methods in Mendelian randomization via penalization of heterogeneous causal estimates
- HMGB1 mediates the development of tendinopathy due to mechanical overloading
- Effects of the Best Possible Self intervention: A systematic review and meta-analysis
- Metabolomic profiling of oxalate-degrading probiotic Lactobacillus acidophilus and Lactobacillus gasseri
- Adjusting cotton planting density under the climatic conditions of Henan Province, China
- Multiple biomarkers of sepsis identified by novel time-lapse proteomics of patient serum
- PTSD in prison settings: A systematic review and meta-analysis of comorbid mental disorders and problematic behaviours
- The female presence in different organisational positions and performance in secondary schools: Does a woman leader function as mediator?
- Beta power encodes contextual estimates of temporal event probability in the human brain
- Molecular characterization of measles virus strains circulating in Cameroon during the 2013-2016 epidemics
- Using metabolite profiling to construct and validate a metabolite risk score for predicting future weight gain
- Comprehensive analysis of the internal structure and firmness in American cranberry (Vaccinium macrocarpon Ait.) fruit
- Predicting spinal profile using 3D non-contact surface scanning: Changes in surface topography as a predictor of internal spinal alignment
- Assessment modelling approaches for stocks with spawning components, seasonal and spatial dynamics, and limited resources for data collection
- Qualitative analysis of ward staff experiences during research of a novel suicide-prevention psychological therapy for psychiatric inpatients: Understanding the barriers and facilitators
- De-climatizing food security: Lessons from climate change micro-simulations in Peru
- Influence of musculotendon geometry variability in muscle forces and hip bone-on-bone forces during walking
- An international survey of perceptions of the 2014 FIFA World Cup: National levels of corruption as a context for perceptions of institutional corruption
- Dissuasive effect, information provision, and consumer reactions to the term ‘Biotechnology’: The case of reproductive interventions in farmed fish
- "If I have a cancer, it is not my fault I am a refugee”: A qualitative study with expert stakeholders on cancer care management for Syrian refugees in Jordan
- The effect of the use of a decision aid with individual risk estimation on the mode of delivery after a caesarean section: A prospective cohort study
- Geographical location influences the composition of the gut microbiota in wild house mice (Mus musculus domesticus) at a fine spatial scale
- High-throughput RNA-sequencing identifies mesenchymal stem cell-induced immunological signature in a rat model of corneal allograft rejection
- Evaluation of the pain intensity differences among hospitalized cancer patients based on a nursing information system
- Effects of chitin synthesis inhibitor treatment on Lepeophtheirus salmonis (Copepoda, Caligidae) larvae
- Protective mechanism of 1-methylhydantoin against lung injury induced by paraquat poisoning
- Use of high-content analysis and machine learning to characterize complex microbial samples via morphological analysis
- Investigation of a spatial coupling relationship between carbon emission performance and regional urbanization in China
- A mutation in mouse Krüppel-like factor 15 alters the gut microbiome and response to obesogenic diet
- Excellent outcome after desensitization in high immunologic risk kidney transplantation
- Characterization of a new composite membrane for point of need paper-based micro-scale microbial fuel cell analytical devices
- Acute kidney injury during an ultra-distance race
- A mitochondria-targeted fatty acid analogue influences hepatic glucose metabolism and reduces the plasma insulin/glucose ratio in male Wistar rats
- The role of C-reactive protein levels on the association of physical activity with lung function in adults
- The CrowdWater game: A playful way to improve the accuracy of crowdsourced water level class data
- Therapeutic efficacy of neuregulin 1-expressing human adipose-derived mesenchymal stem cells for ischemic stroke
- CRISPR/Cas9-based editing of a sensitive transcriptional regulatory element to achieve cell type-specific knockdown of the NEMO scaffold protein
- Exploring the microbiota of upper respiratory tract during the development of pneumonia in a mouse model
- Improved ICU mortality prediction based on SOFA scores and gastrointestinal parameters
- Social information use and collective foraging in a pursuit diving seabird
- Ozone effects on blood biomarkers of systemic inflammation, oxidative stress, endothelial function, and thrombosis: The Multicenter Ozone Study in oldEr Subjects (MOSES)
- Human osteocyte expression of Nerve Growth Factor: The effect of Pentosan Polysulphate Sodium (PPS) and implications for pain associated with knee osteoarthritis
- Prevalence of Epstein-Barr virus, human papillomavirus, cytomegalovirus and herpes simplex virus type 1 in patients with diabetes mellitus type 2 in south-eastern Poland
- Social and structural factors associated with substance use within the support network of adults living in precarious housing in a socially marginalized neighborhood of Vancouver, Canada
- Characterization of Monkeypox virus dissemination in the black-tailed prairie dog (Cynomys ludovicianus) through in vivo bioluminescent imaging
- LPS induces inflammatory chemokines via TLR-4 signalling and enhances the Warburg Effect in THP-1 cells
- How do seabirds modify their search behaviour when encountering fishing boats?
- The diagnostic value of pleural fluid homocysteine in malignant pleural effusion
- Spatio-temporal variations in wheat aphid populations and their natural enemies in four agro-ecological zones of Pakistan
- Factors associated with burnout amongst healthcare workers providing HIV care in Malawi
- A high-density exome capture genotype-by-sequencing panel for forestry breeding in Pinus radiata
- Self-management action and motivation of Pacific adults in New Zealand with end-stage renal disease
- Drought mediated physiological and molecular changes in muskmelon (Cucumis melo L.)
- A prospective randomized trial on abacavir/lamivudine plus darunavir/ritonavir or raltegravir in HIV-positive drug-naïve patients with CD4<200 cells/uL (the PRADAR study)
- Analyzing data from the digital healthcare exchange platform for surveillance of antibiotic prescriptions in primary care in urban Kenya: A mixed-methods study
- Multi-dimensional evaluation of response to salt stress in wheat
- Tuberculosis in the wild boar: Frequentist and Bayesian estimations of diagnostic test parameters when Mycobacterium bovis is present in wild boars but at low prevalence
- Enhanced mechanical and thermal properties of electrically conductive TPNR/GNP nanocomposites assisted with ultrasonication
- Geospatial modeling of microcephaly and zika virus spread patterns in Brazil
- Maternal cardiovascular-related single nucleotide polymorphisms, genes, and pathways associated with early-onset preeclampsia
- A ten-year review of ESBL and non-ESBL Escherichia coli bloodstream infections among children at a tertiary referral hospital in South Africa
- Reference values for the cervical spinal canal and the vertebral bodies by MRI in a general population
- Dynamic mechanical characteristics and failure mode of serpentine under a three-dimensional high static load and frequent dynamic disturbance
- Incorporating statistical strategy into image analysis to estimate effects of steam and allyl isocyanate on weed control
- Regulation of NF-κB- and STAT1-mediated plasmacytoid dendritic cell functions by A20
- The erythrocyte membrane stability is associated with sleep time and social jetlag in shift workers
- New space-time block codes from spectral norm
- Mexican BRCA1 founder mutation: Shortening the gap in genetic assessment for hereditary breast and ovarian cancer patients
- GIVE me your attention: Differentiating goal identification and goal execution components of the anti-saccade effect
- Maternal serum retinol, 25(OH)D and 1,25(OH)2D concentrations during pregnancy and peak bone mass and trabecular bone score in adult offspring at 26-year follow-up
- Self Multi-Head Attention-based Convolutional Neural Networks for fake news detection
- Why are Chinese workers so unhappy? A comparative cross-national analysis of job satisfaction, job expectations, and job attributes
- Fecal indicator bacteria and virus removal in stormwater biofilters: Effects of biochar, media saturation, and field conditioning
- Personalized microstructural evaluation using a Mahalanobis-distance based outlier detection strategy on epilepsy patients’ DTI data – Theory, simulations and example cases
- Radiographic assessment of pectoral flipper bone maturation in bottlenose dolphins (Tursiops truncatus), as a novel technique to accurately estimate chronological age
- Intraoperative measurement of intraventricular pressure in dogs with communicating internal hydrocephalus
- Relative importance of gene effects for nitrogen-use efficiency in popcorn
- Comparative analysis uncovers the limitations of current molecular detection methods for Fusarium oxysporum f. sp. cubense race 4 strains
- The accuracy of the frontal extent in stereoscopic environments: A comparison of direct selection and virtual cursor techniques
- Confronting pastoralists’ knowledge of cattle breeds raised in the extensive production systems of Benin with multivariate analyses of morphological traits
- CH(II), a cerebroprotein hydrolysate, exhibits potential neuro-protective effect on Alzheimer’s disease
- Decontamination of aerosolised bacteria from a pig farm environment using a pH neutral electrochemically activated solution (Ecas4 anolyte)
- Transcriptomic changes triggered by ouabain in rat cerebellum granule cells: Role of α3- and α1-Na+,K+-ATPase-mediated signaling
- Simultaneous transcriptome analysis of oil palm clones and Phytophthora palmivora reveals oil palm defense strategies
- Antifungal effects of a 1,3,4-thiadiazole derivative determined by cytochemical and vibrational spectroscopic studies
- Risk factors for unsuccessful tuberculosis treatment outcomes in children
- CRISPR-based tools for targeted transcriptional and epigenetic regulation in plants
- Reliability of high-resolution ultrasound and magnetic resonance arthrography of the shoulder in patients with sports-related shoulder injuries
- Spatial-temporal variation characteristics and evolution of the global industrial robot trade: A complex network analysis
- Axial variation of deoxyhemoglobin density as a source of the low-frequency time lag structure in blood oxygenation level-dependent signals
- On the sustainability of a family planning program in Nigeria when funding ends
- The epidemiology of antidepressant use in South Korea: Does short-term antidepressant use affect the relapse and recurrence of depressive episodes?
- Injury severity level and associated factors among road traffic accident victims attending emergency department of Tirunesh Beijing Hospital, Addis Ababa, Ethiopia: A cross sectional hospital-based study
- How chimpanzees (Pan troglodytes) share the spoils with collaborators and bystanders
- Seed treatment using methyl jasmonate induces resistance to rice water weevil but reduces plant growth in rice
- Placebo analgesia induced by verbal suggestion in the context of experimentally induced fear and anxiety
- Reconsidering the associations between self-reported alcohol use disorder and mental health problems in the light of co-occurring addictions in young Swiss men
- Learning to assist smokers through encounters with standardized patients: An innovative training for physicians in an Eastern European country
- Serum E-selectin concentration is associated with risk of metabolic syndrome in females
- Lipid and fatty acid dynamics by maternal Pacific bluefin tuna
- Adherence to evidence-based recommendations for surgical site infection prevention: Results among Italian surgical ward nurses
- Novel synergistic fungicidal mixtures of oxathiapiprolin protect sunflower seeds from downy mildew caused by Plasmopara halstedii
- Adjustment of a numerical model for pore pressure generation during an earthquake
- The risk, perceived and actual, of developing type 2 diabetes mellitus for mothers of preschool children in urban China
- Effects of turning frequency on the nutrients of Camellia oleifera shell co-compost with goat dung and evaluation of co-compost maturity
- Imaging disease activity of rheumatoid arthritis by macrophage targeting using second generation translocator protein positron emission tomography tracers
- Distribution of SET/I2PP2A protein in gastrointestinal tissues
- Spontaneous lymphoblastoid cell lines from patients with Epstein-Barr virus infection show highly variable proliferation characteristics that correlate with the expression levels of viral microRNAs
- Early pre- and postsynaptic decrease in glutamatergic and cholinergic signaling after spinalization is not modified when stimulating proprioceptive input to the ankle extensor α-motoneurons: Anatomical and neurochemical study
- Anatomy of a demand shock: Quantitative analysis of crowding in hospital emergency departments in Victoria, Australia during the 2009 influenza pandemic
- Oregano essential oil vapour prevents Plasmopara viticola infection in grapevine (Vitis Vinifera) and primes plant immunity mechanisms
- Dual inhibitory action of trazodone on dorsal raphe serotonergic neurons through 5-HT1A receptor partial agonism and α1-adrenoceptor antagonism
- Optimising poly(lactic-co-glycolic acid) microparticle fabrication using a Taguchi orthogonal array design-of-experiment approach
- Repetitive finger movement and circle drawing in persons with Parkinson’s disease
- The association between family members’ migration and cognitive function among people left behind in China
- Association between long-term adherence to class-I recommended medications and risk for potentially preventable heart failure hospitalizations among younger adults
- Differential role of r-met-hu G-CSF on male reproductive function and development in prepubertal domestic mammals
- Agreement between the spatiotemporal gait parameters from two different wearable devices and high-speed video analysis
- In-hospital cardiopulmonary resuscitation of patients with cirrhosis: A population-based analysis
- Vitamin D treatment of peripheral blood mononuclear cells modulated immune activation and reduced susceptibility to HIV-1 infection of CD4+ T lymphocytes
- Someone like me: Size-assortative pairing and mating in an Amazonian fish, sailfin tetra Crenuchus spilurus
- Seasonality of antenatal care attendance, maternal dietary intake, and fetal growth in the VHEMBE birth cohort, South Africa
- Are trials of psychological and psychosocial interventions for schizophrenia and psychosis included in the NICE guidelines pragmatic? A systematic review
- Incidence of retinal vein occlusion with long-term exposure to ambient air pollution
- Inclusion of enclosed hydration effects in the binding free energy estimation of dopamine D3 receptor complexes
- Intensity modulated radiation therapy following lumpectomy in early-stage breast cancer: Patterns of use and cost consequences among Medicare beneficiaries
- The ‘Saw but Forgot’ error: A role for short-term memory failures in understanding junction crashes?
- Multiscale Modelling Tool: Mathematical modelling of collective behaviour without the maths
- A comparison of machine learning algorithms for the surveillance of autism spectrum disorder
- Drivers of deforestation in the basin of the Usumacinta River: Inference on process from pattern analysis using generalised additive models
- Structure of Dictyostelium discoideum telomeres. Analysis of possible replication mechanisms
- Multidrug-resistant profile and prevalence of extended spectrum β-lactamase and carbapenemase production in fermentative Gram-negative bacilli recovered from patients and specimens referred to National Reference Laboratory, Addis Ababa, Ethiopia
- Primary myelofibrosis marrow-derived CD14+/CD34- monocytes induce myelofibrosis-like phenotype in immunodeficient mice and give rise to megakaryocytes
- Intersubject MVPD: Empirical comparison of fMRI denoising methods for connectivity analysis
- Why Cohen’s Kappa should be avoided as performance measure in classification
- A novel strategy for interpreting the T-SPOT.TB test results read by an ELISPOT plate imager
- Computational identification of key genes that may regulate gene expression reprogramming in Alzheimer’s patients
- NPHP proteins are binding partners of nucleoporins at the base of the primary cilium
- Intensive measures of luminescence in GaN/InGaN heterostructures
- The effect of a web-based training for improving primary health care providers’ knowledge about diabetes mellitus management in rural China: A pre-post intervention study
- Isolation, identification and characterization of Streptomyces metabolites as a potential bioherbicide
- Quantitative magnetic resonance imaging indicates brain tissue alterations in patients after liver transplantation
- DNA analysis of Castanea sativa (sweet chestnut) in Britain and Ireland: Elucidating European origins and genepool diversity
- Forecasting the impact of population ageing on tuberculosis incidence
- Conformation and mechanical property of rpoS mRNA inhibitory stem studied by optical tweezers and X-ray scattering
- Voxelwise statistical methods to localize practice variation in brain tumor surgery
- Identification and evolutionary characterization of salt-responsive transcription factors in the succulent halophyte Suaeda fruticosa
- Integrating temperature-dependent life table data into Insect Life Cycle Model for predicting the potential distribution of Scapsipedus icipe Hugel & Tanga
- Rollout of ShangRing circumcision with active surveillance for adverse events and monitoring for uptake in Kenya
- Comparative phenotypic profiling of the JAK2 inhibitors ruxolitinib, fedratinib, momelotinib, and pacritinib reveals distinct mechanistic signatures
- Analyzing a networked social algorithm for collective selection of representative committees
- Gene expression profiling of skeletal myogenesis in human embryonic stem cells reveals a potential cascade of transcription factors regulating stages of myogenesis, including quiescent/activated satellite cell-like gene expression
- Ex vivo physiological compression of human osteoarthritis cartilage modulates cellular and matrix components
- EFForTS-LGraf: A landscape generator for creating smallholder-driven land-use mosaics
- Impact of the severity of negative energy balance on gene expression in the subcutaneous adipose tissue of periparturient primiparous Holstein dairy cows: Identification of potential novel metabolic signals for the reproductive system
- Precision and consistency of the passive leg raising maneuver for determining fluid responsiveness with bioreactance non-invasive cardiac output monitoring in critically ill patients and healthy volunteers
- Optimizing bacterial DNA extraction in urine
- Adherences to oral nutritional supplementation among hospital outpatients: An online cross-sectional survey in Japan
- Effects of inorganic nitrogen and litters of Masson Pine on soil organic carbon decomposition
- Antioxidant properties of potato tubers (Solanum tuberosum L.) as a consequence of genetic potential and growing conditions
- Transcatheter aortic valve implantation versus conservative management for severe aortic stenosis in real clinical practice
- “I put it in my head that the supplement would help me”: Open-placebo improves exercise performance in female cyclists
- Automated diagnosis of heart valve degradation using novelty detection algorithms and machine learning
- Spatiotemporal clustering of malaria in southern-central Ethiopia: A community-based cohort study
- Studying the link between physiological performance of Crotalaria ochroleuca and the distribution of Ca, P, K and S in seeds with X-ray fluorescence
- Characterization of bony changes localized to the cervical articular processes in a mixed population of horses
- Heat shock-induced chaperoning by Hsp70 is enabled in-cell
- Disability and its association with sociodemographic factors among elderly persons residing in an urban resettlement colony, New Delhi, India
- Correlates of prenatal and postnatal mother-to-infant bonding quality: A systematic review
- IGFBP2 promotes immunosuppression associated with its mesenchymal induction and FcγRIIB phosphorylation in glioblastoma
- Dietary supplementation with the extract from Eucommia ulmoides leaves changed epithelial restitution and gut microbial community and composition of weanling piglets
- How did that interaction make you feel? The relationship between quality of everyday social experiences and emotion in people with and without schizophrenia
- Effects of Lyse-It on endonuclease fragmentation, function and activity
- Overexpression of rice gene OsATG8b confers tolerance to nitrogen starvation and increases yield and nitrogen use efficiency (NUE) in Arabidopsis
- Gait can reveal sleep quality with machine learning models
- Blast vacuolization in AML patients indicates adverse-risk AML and is associated with impaired survival after intensive induction chemotherapy
- Mitochondrial fragmentation and network architecture in degenerative diseases
- Quadriceps muscle strength is a discriminant predictor of dependence in daily activities in nursing home residents
- Discovery of novel West Nile Virus protease inhibitor based on isobenzonafuranone and triazolic derivatives of eugenol and indan-1,3-dione scaffolds
- Skin-associated lactic acid bacteria from North American bullfrogs as potential control agents of Batrachochytrium dendrobatidis
- Microbiota of MR1 deficient mice confer resistance against Clostridium difficile infection
- The responses of extracellular enzyme activities and microbial community composition under nitrogen addition in an upland soil
- Post-translational S-glutathionylation of cofilin increases actin cycling during cocaine seeking
- Absolute pitch can be learned by some adults
- Anger while driving in Mexico City
- Glomerular hyperfiltration may be a novel risk factor of restrictive spirometry pattern: Analysis of the Korea National Health and Nutrition Examination Survey (KNHANES) 2009-2015
- Survival of infants ≤24 months of age with brain tumors: A population-based study using the SEER database
- Multiple evoked and induced alpha modulations in a visual attention task: Latency, amplitude and topographical profiles
- Heart rate variability reduction is related to a high amount of visceral adiposity in healthy young women
- Serum and urinary metabolomics and outcomes in cirrhosis
- Optimal threshold of adherence to lipid lowering drugs in predicting acute coronary syndrome, stroke, or mortality: A cohort study
- Systemic antibiotic prophylaxis does not affect infectious complications in pediatric burn injury: A meta-analysis
- How Knowledge Stock Exchanges can increase student success in Massive Open Online Courses
- CT-perfusion in peripheral arterial disease – Correlation with angiographic and hemodynamic parameters
- Pattern of health care utilization and traditional and complementary medicine use among Ebola survivors in Sierra Leone
- Respiratory variations in pulse pressure and photoplethysmographic waveform amplitude during positive expiratory pressure and continuous positive airway pressure in a model of progressive hypovolemia
- Dorsal tongue porphyrin autofluorescence and Candida saprophytism: A prospective observational study
- A usability study to improve a clinical decision support system for the prescription of antibiotic drugs
- Occurrence of and risk factors for extended-spectrum cephalosporin-resistant Enterobacteriaceae determined by sampling of all Norwegian broiler flocks during a six month period
- Healthcare facility-based strategies to improve tuberculosis testing and linkage to care in non-U.S.-born population in the United States: A systematic review
- Correction: Reward abundance interferes with error-based learning in a visuomotor adaptation task
- Correction: Potential user interest in new long-acting contraceptives: Results from a mixed methods study in Burkina Faso and Uganda
- Correction: Recombinant rabbit beta nerve growth factor production and its biological effects on sperm and ovulation in rabbits
- Critically ill patients with community-onset intraabdominal infections: Influence of healthcare exposure on resistance rates and mortality
- Validating a popular outpatient antibiotic database to reliably identify high prescribing physicians for patients 65 years of age and older
- Metabolisable energy content in canine and feline foods is best predicted by the NRC2006 equation
- Group conquers efficacy: Preschoolers’ imitation under conflict between minimal group membership and behavior efficacy
- Warmth and competence stereotypes about immigrant groups in Germany
- Social resistance drives persistent transmission of Ebola virus disease in Eastern Democratic Republic of Congo: A mixed-methods study
- ER stress activation in the intestinal mucosa but not in mesenteric adipose tissue is associated with inflammation in Crohn’s disease patients
- Enhancing percutaneous pedicle screw fixation with hydroxyapatite granules: A biomechanical study using an osteoporotic bone model
- Optimum plant density for crowding stress tolerant processing sweet corn
- Sign and goal tracker rats process differently the incentive salience of a conditioned stimulus
- Interocular symmetry, intraobserver repeatability, and interobserver reliability of cone density measurements in the 13-lined ground squirrel
- Plasma metabolite biomarkers for multiple system atrophy and progressive supranuclear palsy
- Knowledge, attitudes and practices of livestock and aquaculture producers regarding antimicrobial use and resistance in Vietnam
- Scientific sinkhole: The pernicious price of formatting
- Resource consumption of multi-substance users in the emergency room: A neglected patient group
- Association between distress and knowledge among parents of autistic children
- Surgical approach for complete cochlear coverage in EAS-patients after residual hearing loss
- The impact of a rapid molecular identification test on positive blood cultures from critically ill with bacteremia: A pre-post intervention study
- Shortening duration of ertapenem in outpatient parenteral antimicrobial therapy for complicated urinary tract infections: A retrospective study
- Measurement and analysis of partial lightning currents in a head phantom
- Within species expressed genetic variability and gene expression response to different temperatures in the rotifer Brachionus calyciflorus sensu stricto
- Repeated transspinal stimulation decreases soleus H-reflex excitability and restores spinal inhibition in human spinal cord injury
- Expression of Concern: Resveratrol Enhances Antitumor Activity of TRAIL in Prostate Cancer Xenografts through Activation of FOXO Transcription Factor
- Correlation of CT texture changes with treatment response during radiation therapy for esophageal cancer: An exploratory study
- Modeling spatial variation in density of golden eagle nest sites in the western United States
- Retraction: Autophagy in Muscle of Glucose-Infusion Hyperglycemia Rats and Streptozotocin-Induced Hyperglycemia Rats via Selective Activation of m-TOR or FoxO3
- Correction: In Porphyromonas gingivalis VimF Is Involved in Gingipain Maturation through the Transfer of Galactose
- Gibberellic acid in Citrus spp. flowering and fruiting: A systematic review
- Discharge care quality in hospitalised elderly patients: Extended validation of the Discharge Care Experiences Survey
- A novel therapeutic strategy for esophageal varices using endoscopic treatment combined with splenic artery embolization according to the Child-Pugh classification
- Correction: Development of a high-throughput assay to measure measles neutralizing antibodies
- Correction: Provider preference for payment method under a national health insurance scheme: A survey of health insurance-credentialed health care providers in Ghana
- Correction: Second-line HIV treatment failure in sub-Saharan Africa: A systematic review and meta-analysis
- Potential impact of efflux pump genes in mediating rifampicin resistance in clinical isolates of Mycobacterium tuberculosis from India
- Feed-forward visual processing suffices for coarse localization but fine-grained localization in an attention-demanding context needs feedback processing
- Level Set method-based two-dimensional numerical model for simulation of nonuniform open-channel flow
- Compared to non-drinkers, individuals who drink alcohol have a more favorable multisystem physiologic risk score as measured by allostatic load
- Effect of poor glycaemic control on plasma levels and activity of protein C, protein S, and antithrombin III in type 2 diabetes mellitus
- Retraction: IL-21 Regulates the Differentiation of a Human γδ T Cell Subset Equipped with B Cell Helper Activity
- Sugar transporters in Fabaceae, featuring SUT MST and SWEET families of the model plant Medicago truncatula and the agricultural crop Pisum sativum
- Prediction of lymphovascular space invasion in endometrial cancer using the 55-gene signature selected by DNA microarray analysis
- Research on multi-agent genetic algorithm based on tabu search for the job shop scheduling problem
- Diagnosing the current state of out-of-field teaching in high school science and mathematics
- Sensitivity of the fasciae to sex hormone levels: Modulation of collagen-I, collagen-III and fibrillin production
- Comorbidity of age-related macular degeneration with Alzheimer’s disease: A histopathologic case-control study
- Acute ex vivo changes in brain white matter diffusion tensor metrics
- Regulatory interaction between the ZPBP2-ORMDL3/Zpbp2-Ormdl3 region and the circadian clock
- The effect of bacteria on planula-larvae settlement and metamorphosis in the octocoral Rhytisma fulvum fulvum
- Sodium alginate potentiates antioxidant defense and PR proteins against early blight disease caused by Alternaria solani in Solanum lycopersicum Linn.
- Ground reaction forces and muscle activity while walking on sand versus stable ground in individuals with pronated feet compared with healthy controls
- Correction: Roadway traffic crash prediction using a state-space model based support vector regression approach
- MET as resistance factor for afatinib therapy and motility driver in gastric cancer cells
- Genetic analysis and fine mapping of a qualitative trait locus wpb1 for albino panicle branches in rice
- Clinical features of pulmonary embolism in patients with lung cancer: A meta-analysis
- Cinobufacini ameliorates experimental colitis via modulating the composition of gut microbiota
- Factors restraining the population growth of Varroa destructor in Ethiopian honey bees (Apis mellifera simensis)
- Coastal proximity of populations in 22 Pacific Island Countries and Territories
- DKK1 promotes hepatocellular carcinoma inflammation, migration and invasion: Implication of TGF-β1
- Genetic characterization of Angiostrongylus larvae and their intermediate host, Achatina fulica, in Thailand
- Targeted in-vitro-stimulation reveals highly proliferative multi-virus-specific human central memory T cells as candidates for prophylactic T cell therapy
- Influence of ocean circulation and the Kuroshio large meander on the 2018 Japanese eel recruitment season
- Growth response of the ichthyotoxic haptophyte, Prymnesium parvum Carter, to changes in sulfate and fluoride concentrations
- Letrozole treatment of pubertal female mice results in activational effects on reproduction, metabolism and the gut microbiome
- Prognostic nomogram predicts overall survival in pulmonary large cell neuroendocrine carcinoma
- Microbiome profiling of the onion thrips, Thrips tabaci Lindeman (Thysanoptera: Thripidae)
- Characteristics of proximal early gastric cancer differentiating distal early gastric cancer
- Retraction: Impacts of rock properties on Danxia landform formation based on lithological experiments at Kongtongshan National Geopark, northwest China
- Correction: SVR12 rates higher than 99% after sofosbuvir/velpatasvir combination in HCV infected patients with F0-F1 fibrosis stage: A real world experience
- Retraction: Plexin-B1 Activates NF-κB and IL-8 to Promote a Pro-Angiogenic Response in Endothelial Cells
- Relationship between cognitive behavioral variables and mental health status among university students: A meta-analysis
- Association between temperature, sunlight hours and alcohol consumption
- Using graph learning to understand adverse pregnancy outcomes and stress pathways
- Correction: The step-to-step transition mode: A potential indicator of first-fall risk in elderly adults?
- Surgical referral systems in low- and middle-income countries: A review of the evidence
- In vivo clearance of nanoparticles by transcytosis across alveolar epithelial cells
- Correction: The Economic Impact of Malignant Catarrhal Fever on Pastoralist Livelihoods
- Correction: Identification of miRNAs involved in fruit ripening by deep sequencing of Olea europaea L. transcriptome
- Correction: Characterization of ecto- and endoparasite communities of wild Mediterranean teleosts by a metabarcoding approach
- Correction: Vascular Endothelial Growth Factor Receptor-2 Couples Cyclo-Oxygenase-2 with Pro-Angiogenic Actions of Leptin on Human Endothelial Cells
- Correction: Plant traits linked to field-scale flammability metrics in prescribed burns in Eucalyptus forest
- Correction: Maturation of three-dimensional, hiPSC-derived cardiomyocyte spheroids utilizing cyclic, uniaxial stretch and electrical stimulation
- Correction: To keep or not to keep? Decision making in adolescent pregnancies in Jamestown, Ghana
- PLOS One
- Archiv čísel
- Aktuální číslo
- Informace o časopisu
Nejčtenější v tomto čísle- Graviola (Annona muricata) attenuates behavioural alterations and testicular oxidative stress induced by streptozotocin in diabetic rats
- CH(II), a cerebroprotein hydrolysate, exhibits potential neuro-protective effect on Alzheimer’s disease
- Comparison between Aptima Assays (Hologic) and the Allplex STI Essential Assay (Seegene) for the diagnosis of Sexually transmitted infections
- Assessment of glucose-6-phosphate dehydrogenase activity using CareStart G6PD rapid diagnostic test and associated genetic variants in Plasmodium vivax malaria endemic setting in Mauritania
Kurzy
Zvyšte si kvalifikaci online z pohodlí domova
Revma Focus: Spondyloartritidy
nový kurz
Autoři: doc. MUDr. Norbert Pauk, Ph.D.
Autoři: prof. MUDr. Vladimír Palička, CSc., Dr.h.c., doc. MUDr. Václav Vyskočil, Ph.D., MUDr. Petr Kasalický, CSc., MUDr. Jan Rosa, Ing. Pavel Havlík, Ing. Jan Adam, Hana Hejnová, DiS., Jana Křenková
Autoři: MUDr. Irena Krčmová, CSc.
Všechny kurzyPřihlášení#ADS_BOTTOM_SCRIPTS#Zapomenuté hesloZadejte e-mailovou adresu, se kterou jste vytvářel(a) účet, budou Vám na ni zaslány informace k nastavení nového hesla.
- Vzdělávání