Cullin4 Is Pro-Viral during West Nile Virus Infection of Mosquitoes
Mosquitoes are responsible for transmitting a large number of human and livestock viruses, like West Nile, dengue and Japanese encephalitis viruses. Infection of female mosquitoes with these viruses during blood feeding elicits an immune response. It is not known how the viruses manage to replicate in spite of this antiviral response. We used an unbiased transcriptome sequencing approach to identify genes differentially regulated after WNV infection resulting in 265 transcripts from various cellular pathways. Ubiquitin-proteasomal pathway, responsible for protein degradation, was found to be important during viral infection in mosquito cells. Using in vitro and in vivo infection models, we identified Culex Cul4 to be acting as pro-viral protein, increasing viral titers. Knockdown of Cul4 in Culex mosquitoes decreased viral titers in mosquito saliva. Identification of this novel immune evasion mechanism adopted by WNV provides new insights into transmission of arbovirus and interaction of WNV with its mosquito vector.
Published in the journal:
. PLoS Pathog 11(9): e32767. doi:10.1371/journal.ppat.1005143
Category:
Research Article
doi:
https://doi.org/10.1371/journal.ppat.1005143
Summary
Mosquitoes are responsible for transmitting a large number of human and livestock viruses, like West Nile, dengue and Japanese encephalitis viruses. Infection of female mosquitoes with these viruses during blood feeding elicits an immune response. It is not known how the viruses manage to replicate in spite of this antiviral response. We used an unbiased transcriptome sequencing approach to identify genes differentially regulated after WNV infection resulting in 265 transcripts from various cellular pathways. Ubiquitin-proteasomal pathway, responsible for protein degradation, was found to be important during viral infection in mosquito cells. Using in vitro and in vivo infection models, we identified Culex Cul4 to be acting as pro-viral protein, increasing viral titers. Knockdown of Cul4 in Culex mosquitoes decreased viral titers in mosquito saliva. Identification of this novel immune evasion mechanism adopted by WNV provides new insights into transmission of arbovirus and interaction of WNV with its mosquito vector.
Introduction
Flaviviruses, such as West Nile virus (WNV) and dengue virus (DENV), pose a huge burden on public healthcare system worldwide. With more than half of world’s population at risk of infection, the geographic distribution of these mosquito-borne flaviviruses is expanding due to increased travel, trade and climate change [1]. First isolated in Uganda in 1937, WNV is now endemic in parts of Africa, Europe, the Middle East, Asia, Australia and the Americas [2]. Transmitted by Culex mosquitoes and causing an acute febrile illness that can lead to severe neurological disease, there is currently no specific vaccine or anti-viral for WNV approved for use in humans [3].
The mammalian response to flavivirus infection has been well studied. Mosquito immune pathways are less well understood but some recent studies have shown that they may play an important role during infection in the vector [4,5]. Although lacking essential components of the mammalian innate and adaptive immune systems, such as interferons, antibodies, B cells, T cells and MHC antigens, mosquitoes have been shown to respond to viral infection by a range of mechanisms including RNA interference (RNAi) and by activation of several evolutionarily conserved signal transduction pathways, include the Toll, Imd/JNK and Jak-STAT [4–7]. Transcriptome analysis using genome-wide microarrays [8–11] have also revealed complex dynamics of mosquito transcripts during infection and identified changes in expression of genes from diverse cellular processes, including ion binding, transport, metabolic processes and peptidase activity. Gene expression is also tissue-specific, with differences reported between midgut and salivary glands [10].
The ubiquitin-proteasomal system is one of the major protein degradation pathways in cells and has been shown to be important during flaviviral infection in mammalian cells [12]. Using a complex set of processes, it affects a myriad of cellular pathways [13]. Ubiquitin itself is a highly conserved 76-amino-acid protein that is highly conserved in sequence from yeast to human [14]. Ubiquitylation is brought about by a cascade of enzymes. E1, ubiquitin activating enzyme, transfers activated ubiquitin to E2, the ubiquitin conjugating enzyme. E3, ubiquitin protein ligase, binds ubiquitin-charged E2 and the substrate, facilitating ligation of ubiquitin to the internal lysine residue on the substrate [15,16]. Substrate specificity is largely determined by the E3 ligase. The E3 family is characterised by the presence of the HECT (Homologous to E6-AP Carboxyl Terminus) [17], RING (Really Interesting New Gene) finger [18], U-box [19] and PHD (Plant Homeo-Domain) [20] or LAP (Leukemia-Associated Protein) finger domains [21]. E3 ligases can work as single or multi-subunit complex. The multi-subunit complexes include a RING-finger subunit and a member of cullin family that binds the RING-finger protein [22]. They also include structural adaptor proteins that link cullin to substrate recognition elements [23].
The ubiquitin-proteasomal pathway has been shown to be important in all stages of viral infection in mammalian cells, including entry, transcription, replication, assembly and exit of virus particles from the cell. A number of ubiquitin enzymes have been found to be involved in the flavivirus infection process. UBE1 has been shown to be important for dengue virus infection in primary human endothelial cells [24]. E3 ubiquitin ligase, CBLL1 (HAKAI) has been found to be important during WNV endocytosis [25], but not in dengue entry [26]. Interestingly, there are also examples of viruses encoding ubiquitin ligases, which lead to evasion of host immunity, by degradation of immune proteins. For example, Kaposi’s sarcoma-associated herpes virus (KSHV) immediate-early transcription factor RTA encodes ubiquitin E3 ligase activity that targets IRF7, a key mediator of type I interferon induction, for proteasome-mediated degradation [27]. As an alternate strategy, viruses also encode adaptors that recruit and redirect host E3 ligases to ubiquitylate host proteins, leading to degradation. Adenoviruses express proteins which recruit a cullin-based E3 ligase to target p53 for degradation [28]. Several paramyxoviruses limit the activity of interferons by targeting STATs for ubiquitylation and degradation via interaction of their highly conserved V proteins and host Cul4A RING E3 ligase [29,30].
Here we use an unbiased approach of transcriptome analysis by deep sequencing of the Culex cell transcriptome to identify genes that are differentially regulated following WNV infection. The results show multiple cellular pathways are involved during infection. Using mosquito infection studies in vitro and in vivo, we determine that the ubiquitin-proteasomal system plays a major role during WNV infection in mosquitoes. We also show that Culex cullin (orthologous to mammalian Cul4A/B) is induced by WNV infection and blocks Jak-STAT signalling, increasing WNV replication.
Results
Experimental design and analysis of transcriptome sequencing data
Hsu cells (Culex quinquefasciatus cell line) were infected with WNV (NY99-4132 strain) at multiplicity of infection (MOI) of 10 and total RNA was collected at 48 h post-infection (hpi) for high-throughput transcriptome sequencing as given in Methods. The experiment was conducted in duplicate and since Pearson correlation coefficients of 0.994 (control) and 0.991 (WNV) indicated close agreement between the biological replicates (S1 Table), data from the replicates was combined for further analysis. The raw sequencing and downstream files were deposited at NCBI with accession code GSE60229.
A total of 265 unique transcripts were identified as differentially accumulated (>2-fold) between control and WNV-infected cells, with 130 transcripts up-regulated and 135 transcripts down-regulated after infection (S2 Table). Ingenuity Pathway Analysis (Ingenuity Systems, www.ingenuity.com) performed on all differentially regulated genes indicated that various pathways and cellular processes were involved during infection, including the immune signalling, the cell-cycle/apoptosis and proteasomal pathways, metabolism genes and the cell transport machinery (Fig 1A). Transcripts, which could not be functionally annotated were grouped as other or unknown. Genes in the ubiquitin-proteasomal pathway comprised 12% of differentially regulated transcripts and were selected for further analysis. To validate the RNA-Seq analysis, the relative abundance of seven differentially up-regulated transcripts in the ubiquitin-proteasomal pathway was determined by real-time RT-qPCR using target-specific primers. The results confirmed that all of the transcripts were up-regulated during infection but the fold-increase was consistently overestimated by RNA-Seq analysis (Fig 1B).
The proteasomal pathway is required for WNV replication in Culex cells
Previous studies have shown that ubiquitin-proteasomal pathway plays an important role in mammalian cells during flavivirus infection [25,31]. Studies have also shown that ubiquitin-related genes are upregulated following bacterial infection in mosquito cells [32]. Experiments were performed to determine the significance of the proteasomal pathway in WNV infected Culex cells. Hsu cells were pretreated with 0.1, 1 or 10 μM MG132 (specific proteasomal inhibitor) from 1 h prior to WNV infection (MOI 10), and supernatant media and total RNA from cells were collected at 48 hpi. Real-time RT-qPCR using primers specific for WNV NS1 gene showed a dose-dependent decrease in viral replication, with the NS1 RNA level reducing by more than 80% following treatment with 10 μM MG132 (Fig 2A). Cell viability assay showed no significant toxicity for MG132 at concentrations used in the assay (S1 Fig). Plaque assays performed on the supernatant media showed a similar dose-dependent decrease in viral titers, with a 20-fold reduction in cells treated with 10 μM MG132 (30 pfu/ml) compared to untreated controls (600 pfu/ml) (Fig 2B). These results suggest the proteasomal pathway is required for efficient WNV replication in Culex cells.
The proteasomal pathway plays an important role post-viral entry
A previous report suggests the proteasomal pathway has a role during entry of WNV into mammalian cells [25]. To test this in the mosquito system, Hsu cells were pre-treated with MG132 at various concentrations (0.1, 1 and 10 μM), infected with WNV (MOI 10) at 4°C for 30 min and then incubated at 30°C. Real-time RT-qPCR using NS1 primers conducted on total RNA from cells collected at 6 hpi showed no significant effect of MG132 treatment, indicating that the proteasome does not play a role during WNV entry to Culex cells (Fig 2C). To determine whether the proteasomal pathway plays significant role post-entry, cells were infected with WNV and treated with 10 μM MG132 from 2, 4, or 6 hpi. Real-time RT-qPCR using NS1 primers conducted on total RNA from cells collected at 48 hpi showed ~80% reduction in viral RNA in all treated samples (Fig 2D). Experiments were also performed to rule out significant contribution by extracellular viral RNA in real time RT-qPCR results (S2 Fig). These results suggest involvement of the proteasomal pathway post-viral entry, possibly during viral transcription.
Culex cullin gene is up-regulated following WNV infection of mosquitoes
Amongst the differentially expressed genes in the ubiquitin-proteasomal pathway, CPIJ010574 was highly up-regulated (>20-fold in RNA-Seq and >12-fold in real-time RT-qPCR) following WNV infection in Culex cells (Fig 1B and S2 Table). CPIJ010574 is orthologous to mammalian Cullin4A and Cullin 4B (~70% amino acid identity with both) (S3 Fig) and is therefore referred to here as CxCul4. Cullin-RING ligases, such as Cullin4A, have been found to be upregulated during WNV infection of mammalian cells and implicated in various cellular processes such cell cycle regulation, signal transduction, DNA replication as well as viral replication [33]. Initially, in vivo validation of RNA-Seq analysis was performed using a mosquito infection model. Female Culex annulirostris mosquitoes were infected with WNV (NY99-4132 strain) by blood-feeding. Total RNA was collected from whole carcasses and dissected midguts at 24 hpi. Real-time RT-qPCR performed using CxCul4-specific primers showed approximately 4 - and 12-fold increases in mRNA in carcass and midgut, respectively, compared with control mosquitoes fed on uninfected blood (Fig 3A).
Culex Cul4 is pro-viral
Gene knock-down experiments were conducted to determine the significance of CxCul4 during WNV infection. Hsu cells were transfected with long dsRNA against CxCul4, infected with WNV at 24 h post-transfection, and total RNA and supernatant media were collected at 48 hpi. As a control, cells were either left untransfected (No dsRNA) or were transfected with dsRNA against GFP (GFP dsRNA). Real-time RT-qPCR showed a significant decrease (>80%) in CxCul4 mRNA, indicating efficient knock-down of the gene (S4 Fig). There was also a significant decrease (>75%) in WNV NS1 RNA in cells treated with CxCul4 dsRNA, indicating a decrease in viral replication, compared to control (No dsRNA and GFP dsRNA) cells (Fig 3B). Plaque assays conducted on supernatant media showed greater than 10-fold decrease in viral titers following CxCul4 knock-down (75 pfu/ml) compared with No dsRNA (900 pfu/ml) and GFP dsRNA (800 pfu/ml) (Fig 3C). In a parallel experiment, western blots performed using anti-NS5 antibody showed a significantly lower level of WNV NS5 in cells treated with CxCul4 dsRNA compared with control cells (GFP dsRNA) (Fig 3D).
To further investigate the role of CxCul4, Hsu cells were transfected with a plasmid containing CxCul4 cloned under insect promoter (OpIE2), infected with WNV at 24 h post-transfection, and total RNA and supernatant media were collected at 48 hpi. Real-time RT-qPCR showed increased WNV NS1 levels (>4-fold) in cells transfected with CxCul4 compared with empty vector (Control), indicating increased viral replication (Fig 3E). Plaque assays conducted on supernatant media also showed significantly increased viral titer (> 10-fold) in cells over-expressing CxCul4 compared with control cells (Fig 3F). In a parallel experiment, western blots using V5 antibody was performed on total cell lysates collected from Hsu cells transfected with CxCul4 to confirm exogenous expression level of CxCul4 (Fig 3G). Combined, the above data suggest that CxCul4 plays a significant pro-viral role during WNV infection.
CxCul4 blocks Jak-STAT signaling via the proteasomal pathway
Previous reports have shown that mammalian Cul4A plays a role in degradation of STAT2 by an ubiquitin-proteasomal-dependent pathway. To determine whether CxCul4 plays a similar role during WNV infection, Hsu cells were transfected with plasmid expressing CxCul4 and infected with WNV 24 h post-transfection. Total RNA was collected 48 hpi and real-time RT-qPCR was performed using primers for Vir1, a reporter gene regulated by Jak-STAT pathway [34], and CxVago, a reporter gene regulated by the TRAF-Rel2 pathway [35]. As expected, expression of both CxVir1 and CxVago was upregulated following WNV infection. However, whilst there was no significant difference in CxVago expression following CxCul4 overexpression, CxVir1 upregulation was suppressed significantly in CxCul4-overexpressing cells compared with empty vector transfected cells (Fig 4A). Previous studies have shown that, once expressed, CxVago is secreted and activates the Jak-STAT pathway in Culex cells [7]. Therefore, Hsu cells were transfected with CxVago and the supernatant medium was collected 72 h post-transfection. Fresh Hsu cells were then transfected with the CxCul4 overexpression plasmid and, at 24 h post-transfection, the medium was replaced with medium containing CxVago to activate the Jak-STAT pathway. Real-time RT-qPCR conducted on total RNA collected 48 h after media replacement showed expression of CxVir1 was upregulated in control (empty vector transfected) cells but upregulation of CxVir1 was suppressed significantly in cells overexpressing CxCul4 (Fig 4B). These results indicate that CxCul4 functions to inhibit the Jak-STAT pathway in Culex cells.
To further confirm that CxCul4 is a negative regulator of Jak-STAT pathway, Hsu cells were transfected with a plasmid (p6x2DRAF-Luc) containing a Firefly luciferase reporter gene under Drosophila STAT-responsive elements, along with dsRNA against CxCul4. After 24 h, cells were infected with WNV and luciferase activity was measured 16 hpi. The results showed that CxCul4 knockdown resulted in increased luciferase activity in WNV-infected cells (Fig 4C). As a positive control, cells were stimulated with heat-inactivated E. coli for 1 h, which also showed increased luciferase activity.
To determine whether Cul4 acts via the proteasomal pathway, Hsu cells were transfected with the CxCul4 overexpression plasmid and, at 24 h post-transfection, infected with WNV and treated simultaneously with either MG132 (10 μM) or the ubiquitin activating enzyme E1 inhibitor PYR-41 (10 μM). Real-time RT-qPCR conducted on total RNA collected 48 hpi showed decreased CxVir1 expression in cells overexpressing CxCul4 compared with control (empty vector) cells in WNV infected cells. However, treatment of cells overexpressing CxCul4 with MG132 or PYR-41 resulted in significantly higher levels of CxVir1 expression compared with untreated cells. Real-time RT-qPCR for WNV NS1 showed there was a decrease in viral replication in cells transfected with CxCul4 and treated with MG132 or PYR-41 compared with the control (CxCul4 transfection alone) (Fig 4D). To further determine significance of CxCul4 in STAT signaling, Hsu cells were transfected with dsRNA against CxCul4. As a control, cells were either not transfected (No dsRNA) or transfected with dsRNA against GFP (GFP dsRNA). Cells were infected with WNV 24 hours post-transfection and total RNA was collected 48 hpi. Real time RT-qPCR using CxVir1 primers showed increased expression after WNV infection which was further increased in cells transfected with CxCul4 dsRNA (Fig 4E). CxVago on the other hand showed increased expression after WNV infection with no further increase in cells with CxCul4 dsRNA. To determine that action of CxCUl4 is via CxSTAT, cells were transfected with CxSTAT dsRNA along with dsRNA against CxCul4. Cells were infected with WNV 24 hours post-transfection. Total RNA was collected 48 hpi and real time RT-qPCR using WNV NS1 primers showed significant increase in cells with CxSTAT dsRNA and decrease in cells with CxCul4 dsRNA. Cells containing both CxCul4 and CxSTAT dsRNA showed no decrease in WNV NS1 levels indicating that CxCul4 action required CxSTAT (Fig 4F). These results confirm that pro-viral effect of CxCul4 is via ubiquitin-proteasomal pathway.
To determine which WNV protein expression leads to overexpression of CxCul4, Hsu cells were transfected with select individual WNV genes cloned in insect vector (pIZ-V5/His). Total RNA was collected 48 hours post-transfection and real time RT-qPCR was performed using CxCul4 primers. As a control, real time RT-qPCR was performed using CxRpL32 primers. Western blot was performed on duplicate cells to confirm transfection and protein expression using anti-V5 antibody (S6 Fig). The results showed up-regulation of CxCul4 expression in cells transfected with WNV-NS1 (2 fold) and WNV-NS5 (3 fold) genes (Fig 5A). This indicates NS1 and NS5 may be involved in upregulation of CxCul4 after WNV infection in Culex cells. As a control, expression of CxCullin3 (CPIJ011310) was measured after WNV infection or overexpression of WNV NS1 and NS5. Results showed no significant change in expression level (Fig 5B), indicating effect of WNV is specific to CxCul4.
Experiments were performed to determine whether WNV infection leads to STAT degradation via CxCul4. Hsu cells were transfected with dsRNA against CxCul4 and infected with WNV at 24 h post-transfection. Total cell lysates were collected at 24 hours post-infection and Western blot was performed using anti-CxSTAT antibody. As a control, cells were either transfected with GFP dsRNA (Control). The results (Fig 5C) showed cells infected with WNV showed decreased CxSTAT levels, which returned to baseline in cells transfected with dsRNA against CxCul4. Although, we cannot rule out the possibility that reduced degradation of CxSTAT upon CxCul4 knockdown is due to lower virus replication, these results combined with other data indicate that WNV infection leads to degradation of CxSTAT via CxCul4.
To further establish this, Hsu cells were transfected with WNV-NS1, WNV-NS5 or WNV-NS3 genes with or without transfection with dsRNA against CxCul4. As a control cells were transfected with dsRNA against GFP. Cell lysates were collected 48 hours post-transfection. Western blot was performed using anti-CxSTAT antibody. The results showed decreased STAT levels in cells transfected with WNV-NS1 or WNV-NS5 (Fig 5D). The levels returned to baseline in cells also transfected with dsRNA against CxCul4. In WNV-NS3 transfected cells, there was no significant change in STAT level. These results indicate that WNV infection of Culex cells leads to degradation of CxSTAT via CxCul4, activated by WNV NS1 and NS5.
CxCul4, ortholog of mammalian Cullin4A/B, has previously been shown to be responsible for degradation of STAT via ubiquitin-proteasomal pathway. Cullin-RING ubiquitin ligases are responsible for ubiquitylation of target proteins. To determine whether degradation of CxSTAT via CxCul4 occurs by ubiquitylation, Culex cells were transfected with dsRNA against CxCul4 (or GFP dsRNA as control). The cells were infected with WNV and cell lysates collected 48 hours post-infection. Immunoprecipitation was performed using anti-ubiquitin antibody, followed by Western blot using anti-ubiquitin and anti-CxSTAT antibodies. The results (Fig 5E) showed that STAT was co-immunoprecipitated with ubiquitin after WNV infection in control (GFP dsRNA) cells, indicating ubiquitylation of CxSTAT. CxSTAT was not co-immunoprecipitated with ubiquitin in cells transfected with dsRNA against CxCul4. The results suggest that CxCul4 plays a major role in ubiquitylation of CxSTAT after WNV infection.
CxCul4 knockdown reduces viral titers in mosquito saliva
To validate the significance of CxCul4 during viral infection of mosquitoes, female Culex annulirostris mosquitoes were microinjected with dsRNA against CxCul4. As a control, mosquitoes were microinjected with dsRNA against GFP. The mosquitoes were infected with WNV (NY99 strain) by blood-feeding 24 h post-microinjection. At 10 days post-infection, saliva from individual mosquitoes was collected in a capillary tube (see methods) and total RNA was collected from whole mosquito carcass and midgut. As a parallel experiment, mosquitoes were collected at day 2 and day 10 post-infection. Western blot was performed on whole mosquito using anti-CxSTAT and anti-actin antibodies. Results showed increased levels of CxSTAT by day 2 post-infection. The levels decreased to baseline by day 10 post-infection in control mosquitoes (GFP dsRNA); however in mosquitoes with CxCul4 dsRNA, STAT levels remained high (Fig 5E). Real-time RT-qPCR results showed efficient knock-down (>60%) of CxCul4 mRNA in carcass after Cul4 dsRNA microinjections (Fig 6A). The results also showed a decrease (>50%) in viral RNA (NS1) in whole mosquito carcass (Fig 6B) and midgut (Fig 6D) in CxCul4 dsRNA-injected mosquitoes compared with the control, confirming pro-viral effect of CxCul4. Interestingly, real-time RT-qPCR results also showed a significant increase in CxVir1 mRNA expression in carcass (3-fold) (Fig 6C) and midgut (5-fold) (Fig 6E) in CxCul4-knockdown mosquitoes, indicating increased Jak-STAT signaling. Plaque assays performed on mosquito saliva showed a significantly lower virus titer in mosquito saliva microinjected with CxCul4 dsRNA (88 pfu/mosquito) compared with control (GFP dsRNA) (429 pfu/mosquito) (Fig 6F), indicating a lower likelihood of virus transmission by CxCul4 silenced mosquitoes. It should be noted that saliva from 3 mosquitoes with CxCul4 dsRNA injection showed higher viral titers (similar to controls). Further analysis showed that CxCul4 was not efficiently knocked down in these three mosquitoes (Fig 6A, inset). These results further validate that CxCul4 has a pro-viral effect by inhibiting Jak-STAT pathway during WNV infection in mosquitoes. It should also be noted that ~20–30% of mosquitoes from each group did not show any virus in the saliva, possibly indicative of vector competence of these mosquito species.
Discussion
A number of studies have also been performed to identify differentially regulated genes during flavivirus infection in mammalian cells [31,36–39]. Transcriptome studies using genome-wide microarrays or next-generation deep sequencing of the transcriptome, as well as genome-wide siRNA studies, have revealed a number of pathways to be important during infection process [25,31]. These include immune pathways, apoptotic pathways, cellular transport proteins, proteasomal pathways among others.
Previous studies using microarray analyses to characterize the transcriptional response of mosquitoes to flavivirus infection have shown that a multitude of pathways appear to be involved, including the immune, cell-cycle/apoptosis, metabolic and proteasomal pathways as well as other cellular processes such as the transport machinery [10,11]. Here we adopted an unbiased approach using high-throughput deep sequencing of the mosquito cell transcriptome during a synchronized (high multiplicity) infection with WNV. Our data also identified differentially regulated genes from a number of cellular pathways of which we selected ubiquitin-proteasomal pathway for further functional analysis.
Proteasomal inhibition has been shown previously to affect replication of a wide range of viruses in mammalian cells, including herpesviruses [40], poxviruses [41], hepadnaviruses [42], adenoviruses [43], influenza viruses [44], retroviruses [45], coronaviruses [46], paramyxoviruses [47] and rotaviruses [48]. Microarray studies have also shown that several ubiquitin-related genes are induced following infection in mosquito cells [32]. The ubiquitin-proteasomal pathway is one of the major pathways involved in post-translational modifications, leading to degradation of proteins. It has also been implicated in various stages of viral infection in mammalian cells including virus entry, replication and exit [49]. The largest family of ubiquitin ligases (E3) is a group of proteins that contain a RING domain, a structural motif comprising eight cysteine and histidine residues that form the interface with E2 (ubiquitin conjugating) enzyme [18]. Substrate specificity is determined by variant RING ubiquitin ligases and also by multiprotein complexes that contain a conserved RING protein. Cullin RING ubiquitin ligases are one such family of proteins, containing eight mammalian members, each with different substrate specificity [22]. These proteins have been implicated in many cellular processes including cell-cycle regulation and cell signaling. Because of this, cullin RING ubiquitin ligases are frequently targeted by viruses to evade host immunity [33]. Viruses redirect these ligases to select specific host proteins for degradation in order to prevent the host response and promote viral replication and dissemination. For example, viruses have been shown to use cullins to prevent cellular apoptosis by degrading p53 [50] or inhibit the innate antiviral response by blocking interferon signaling [30]. In mammals, interferon is a key component of a major innate defensive response against invading viruses by activating Jak-STAT pathway and the expression of antiviral genes in neighbouring cells [51]. Some members of the Paramyxoviridae have been shown to hijack cullin4A ubiquitin ligase complexes to overcome the interferon response, by promoting degradation of STAT proteins. Specifically, the V protein of simian virus 5 causes degradation of STAT1 [29], while the parainfluenza virus V protein causes degradation of STAT2 via the Cul4A substrate adaptor DDB1 [52].
Recently, Culex Vago, which is induced in mosquitoes in response to WNV infection, was found to be functionally similar to mammalian interferon in that it is activated via the TRAF-NF-κB pathway and, upon secretion, activates the Jak-STAT pathway and an antiviral response in neighbouring cells [7,35]. Our results here suggest that Culex STAT is regulated by Culex Cul4 (mammalian Cul4A/B ortholog), which has proviral activity during WNV infection, and that WNV may target STAT for degradation by inducing Culex Cul4 via NS1 and NS5 proteins. Suppression of the mammalian interferon-mediated Jak-STAT pathway has been shown to be a common property of vector-borne flaviviruses. Dengue NS5 protein has been shown to target STAT2 for degradation [53] and WNV NS5 suppressed phosphorylation of STAT1 [54], leading to decreased signaling in mammalian system. Interestingly, our results suggest that the mosquito Jak-STAT pathway is also targeted by WNV via cullin RING ubiquitin ligase. Although, we have identified WNV NS1 and NS5 proteins to be responsible for upregulation of Cul4, the exact mechanism of this activation remains unknown. WNV NS1 and NS5 proteins have significantly different protein sequences, however both are involved in formation of viral replication complex. Studies are currently underway to determine whether this plays any part in the described mechanism. Our in vivo results also suggest that CxCul4 proviral activity may be mainly localized in the mosquito midgut and knockdown of CxCul4 increases Jak-STAT signaling in the midgut, thus decreasing the overall viral load in the body and, in turn, the saliva of these mosquitoes.
Our unbiased transcriptome analysis also indicated that other genes involved in the ubiquitin-proteasomal pathway, including E1, UBC and other E3 ligases, as well as ubiquitin-specific proteases are differentially expressed during WNV infection, suggesting that this pathway has a critical role in the invertebrate response to infection and/or the viral host evasion strategy. Our results suggest that proteasomal pathway (and CxCullin4) does not play any role in WNV entry in mosquito cells (S5 Fig). This is different than previously reported mechanism in mammalian cells [25]. This may be due to different mechanisms of viral entry in mammalian cells versus mosquito cells. It is also interesting that a number of reads from our data did not map to the published Culex quinquefasciatus transcriptome. Many of these transcripts may be expressed from unannotated genes which contribute to novel host-pathogen interactions in invertebrates.
Here we show that cullin RING ubiquitin ligase (CxCul4) plays an important role during WNV infection of Culex mosquitoes and dengue infection in Aedes albopictus cells (S7 Fig). In vitro and in vivo experiments show that Culex Cul4 (mammalian Cul4A/B ortholog) is induced by WNV infection and acts as a proviral factor by ubiquitylation of STAT in Culex mosquitoes, thus inhibiting the antiviral response. It remains to be seen whether mammalian Cul4A/B act in a similar manner during viral infection. This study opens up a new avenue of research in viral evasion of the mosquito immune system.
Materials and Methods
Cell culture and virus propagation
Hsu (Culex quinquefasciatus) and RML12 (Aedes albopictus) cells were maintained at 28°C in Leibovitz's L-15 medium (Gibco #11415) containing 10% tryptose phosphate broth solution, 15% heat-inactivated fetal bovine serum, and 1% penicillin-streptomycin solution. West Nile virus (NY99–4132 strain) was used for the study. C6/36 (Aedes albopictus) cells were maintained in RPMI medium at 28°C and were used to propagate the virus. Vero cells maintained in EMEM at 37°C were used for plaque assays.
RNA preparation and next-generation sequencing
Total RNA was collected from Hsu cells (control and WNV infected) using Qiagen RNeasy kit following the manufacturer’s instructions. RNA was quantified and checked for quality using a bioanalyser. The experiment was conducted in duplicate with two RNA-Seq libraries generated for WNV-infected cells and two for uninfected control cells. Sequencing was conducted in a single lane of an Illumina HiSeq2000 (Micromon Facility, Monash University, Australia), generating more than 80 million reads per sample (S1 Table).
Sequencing analysis
Sequence reads (paired, 100 bp) were mapped using Tophat v2.0.8 (http://ccb.jhu.edu/software/tophat/index.shtml) [55] to Culex quinquefasciatus (Johannesburg strain, CpipJ2.1) transcripts available from VectorBase (http://www.vectorbase.org) [56]. Differential isoform expression analysis was conducted using Cufflinks v1.3.0 (http://cole-trapnell-lab.github.io/cufflinks/) [57]. Analysis of RNA sequencing quality was performed with FastQC version 0.10.1 (http://www.bioinformatics.babraham.ac.uk/projects/fastqc/) using the default options. Pathway analysis of differentially regulated transcripts was performed using Ingenuity Pathway Analysis v9.0 (Ingenuity Systems, www.ingenuity.com).
RNA extraction and real-time RT-qPCR
Total RNA was extracted from cells using the Qiagen RNA extraction kit according to the manufacturer's protocol. Reverse transcription was performed with random hexamer primers using the First Strand Synthesis kit (Invitrogen). Real-time RT-qPCR was performed using gene-specific primers. As an internal control, real-time RT-qPCR was also performed using the housekeeping gene, RpL32. The control was set arbitrarily at 1 and fold-increase over control was calculated by the ΔΔCt method. The experiments were conducted at least three times, each in triplicates. The results were plotted in graph format as mean ± SD.
Proteasomal/ ubiquitylation inhibitors
MG132 and PYR-41 (Sigma-Aldrich) were used at the described concentrations dissolved in DMSO. For controls, cells were treated with DMSO. For pre-treatment, cells were initially treated with MG132, followed by WNV infection for one hour. This was followed by replacing the medium with medium containing MG132 at appropriate concentrations.
Cell lysis and western blotting
Cells were lysed in RIPA lysis buffer (25 mM Tri-HCl, 150 mM NaCl, 1% NP-40, 0.1% SDS) containing protease inhibitor (Halt protease inhibitor cocktail, Pierce). The cell lysates were collected by centrifugation at 16,000 × g for 10 min at 4°C. Protein samples (10 μg) were loaded onto polyacrylamide gradient gels (4–12%). After electrophoresis and transfer to nitrocellulose membranes, proteins were blotted using anti-Culex STAT (rabbit polyclonal against peptide VVIVHGNQEPQSWATITWDNAFADINRV PFHVPDKVSWNLLAEALNTKYRASTGRSMTQENMHFLC), anti-WNV NS1, anti-WNV NS5 [58] or anti-V5 (Invitrogen) antibody followed by anti-rabbit or anti-mouse secondary antibodies. After adding substrate, the membrane was exposed to film to detect protein levels. Anti-β-actin antibody (Abcam) was used in immunoblots as a loading control.
Plaque assays
Plaque assays were performed as previously described [7]. In brief, supernatant media from cells infected with WNV (10-fold dilutions) were added onto confluent Vero cell monolayers in 6-well plates. After 1 h incubation at 37°C, the cells were overlaid with medium containing agar. Plaques formed within 72 hpi were counted and the results were plotted graphically. The experiments were conducted at least twice, each with duplicates.
dsRNA preparation and transfection
Gene-specific dsRNA (~400 nt) were prepared using the MEGAscript RNAi kit according to the manufacturer's protocol. dsRNAs were transfected into Hsu cells using Cellfectin according to a previously described protocol [7]. dsRNA against green fluorescent protein (GFP) was used as a knock-down specificity control.
Luciferase assay activity
STAT activation experiments were performed as previously described [59]. The STAT reporter plasmids were kindly provided by Prof. Martin Zeidler (University of Sheffield) [60]. In brief, Hsu cells were transfected with STAT reporter plasmid p6x2DRAF-Luc (multimerised Drosophila STAT-responsive element with a Firefly luciferase reporter) and a control plasmid, pAct-Renilla (Renilla luciferase gene under control of the Drosophila actin 5C promoter for constitutive expression). Cells were also transfected with dsRNA against Cul4 or GFP. Cells were stimulated with heat inactivated E. coli, WNV (MOI = 1) or PBS (Control) for 1h. Luciferase activity was measured at 16 h post-stimulation. Heat-inactivated bacteria were prepared by incubating 1μl of E. coli DH5α in 5 ml LB medium at 37°C for 16 h. Cells were harvested by centrifugation and resuspended in 0.5 ml of PBS. Heat inactivation was achieved by incubating the cells for 10 min at 90°C. 1 μl of the suspension was used per well.
Ubiquitylation determination
Hsu cells under various conditions were treated with MG132 (1 μM) for 6 hours to prevent degradation of ubiquitylated proteins. Immunoprecipitation was performed using Pierce Crosslink IP kit (Thermo Scientific) following manufacturer’s protocol. Briefly, cells were lysed using lysis buffer and after preclearing were incubated with anti-ubiquitin antibody (Abcam) crosslinked to beads in column for 18 hours. Flow-through was collected and immunoprecipitate was eluted using elution buffer. The samples were separated on polyacrylamide gel and Western blot was performed using anti-ubiquitin and anti-CxSTAT antibodies.
Mosquito maintenance and viral infections
Culex annulirostris mosquitoes were maintained in a diurnal cycle (12h/12h) with temperatures alternating for 23 and26°C and 65% humidity. Three to five day-old female mosquitoes (n = 40) were blood-fed on chicken skin membranes with WNV (1.13×10∧6 pfu/ml) or 199 medium (as control) and the mosquitoes were incubated at 25°C and 65% humidity in an environmental cabinet (Thermoline Scientific, Smithfield, Australia) with a wet cotton pad (10% sucrose solution) provided daily as a food source. At 24 hpi, surviving females were collected for analysis. For this, mosquito midguts were dissected and homogenized using a bead-beater. RNA extracted using the RNeasy kit (Qiagen) by pooling four samples and was used for real-time RT-qPCR as described above.
Mosquito microinjection and saliva collection
Three to five day-old female mosquitoes (n = 40) were microinjected with dsRNA against CxCul4 or GFP (200 ng/mosquito). Mosquitoes were blood-fed with WNV (1.13×10∧6 pfu/ml) one day later and were maintained in a diurnal cycle (23/26°C) in an environmental cabinet. At 10–12 days post-infection, saliva was collected in capillary tubes containing 5 μl FCS for 10 min using a protocol described previously [61]. Midguts were dissected and homogenized using a bead-beater. RNA was extracted using the RNeasy kit from the midgut and carcass of individual mosquitoes and was used for real-time RTqPCR as described above. Saliva from each mosquito was diluted in 300 μl of L-15 medium and was used to determine viral titer by plaque assay as described above.
Statistical analysis
Standard error of the mean (SEM) was calculated and data analyzed using the non-paired Student's t-test for single mean comparisons.
Supporting Information
Zdroje
1. Gubler DJ, Meltzer M (1999) Impact of dengue/dengue hemorrhagic fever on the developing world. Adv Virus Res 53 : 35–70. 10582094
2. Randolph SE, Rogers DJ (2010) The arrival, establishment and spread of exotic diseases: patterns and predictions. Nat Rev Microbiol 8 : 361–371. doi: 10.1038/nrmicro2336 20372156
3. Krishnan MN, Garcia-Blanco MA (2014) Targeting host factors to treat West Nile and dengue viral infections. Viruses 6 : 683–708. doi: 10.3390/v6020683 24517970
4. Fragkoudis R, Attarzadeh-Yazdi G, Nash AA, Fazakerley JK, Kohl A (2009) Advances in dissecting mosquito innate immune responses to arbovirus infection. Journal of General Virology 90 : 2061–2072. doi: 10.1099/vir.0.013201-0 19570957
5. Souza-Neto JA, Sim S, Dimopoulos G (2009) An evolutionary conserved function of the JAK-STAT pathway in anti-dengue defense. Proceedings of the National Academy of Sciences USA 106 : 17841–17846.
6. Sanchez-Vargas I, Scott JC, Poole-Smith BK, Franz AW, Barbosa-Solomieu V, et al. (2009) Dengue virus type 2 infections of Aedes aegypti are modulated by the mosquito's RNA interference pathway. PLoS Pathog 5: e1000299. doi: 10.1371/journal.ppat.1000299 19214215
7. Paradkar PN, Trinidad L, Voysey R, Duchemin JB, Walker PJ (2012) Secreted Vago restricts West Nile virus infection in Culex mosquito cells by activating the Jak-STAT pathway. Proc Natl Acad Sci U S A 109 : 18915–18920. doi: 10.1073/pnas.1205231109 23027947
8. Zou Z, Souza-Neto J, Xi Z, Kokoza V, Shin SW, et al. (2011) Transcriptome analysis of Aedes aegypti transgenic mosquitoes with altered immunity. PLoS Pathog 7: e1002394. doi: 10.1371/journal.ppat.1002394 22114564
9. Sim S, Jupatanakul N, Ramirez JL, Kang S, Romero-Vivas CM, et al. (2013) Transcriptomic profiling of diverse Aedes aegypti strains reveals increased basal-level immune activation in dengue virus-refractory populations and identifies novel virus-vector molecular interactions. PLoS Negl Trop Dis 7: e2295. doi: 10.1371/journal.pntd.0002295 23861987
10. Colpitts TM, Cox J, Vanlandingham DL, Feitosa FM, Cheng G, et al. (2011) Alterations in the Aedes aegypti transcriptome during infection with West Nile, dengue and yellow fever viruses. PLoS Pathog 7: e1002189. doi: 10.1371/journal.ppat.1002189 21909258
11. Girard YA, Mayhew GF, Fuchs JF, Li H, Schneider BS, et al. (2010) Transcriptome changes in Culex quinquefasciatus (Diptera: Culicidae) salivary glands during West Nile virus infection. J Med Entomol 47 : 421–435. 20496590
12. Hochstrasser M (2000) Evolution and function of ubiquitin-like protein-conjugation systems. Nat Cell Biol 2: E153–157. 10934491
13. Popovic D, Vucic D, Dikic I (2014) Ubiquitination in disease pathogenesis and treatment. Nat Med 20 : 1242–1253. doi: 10.1038/nm.3739 25375928
14. Hershko A, Ciechanover A (1998) The ubiquitin system. Annu Rev Biochem 67 : 425–479. 9759494
15. Thrower JS, Hoffman L, Rechsteiner M, Pickart CM (2000) Recognition of the polyubiquitin proteolytic signal. EMBO J 19 : 94–102. 10619848
16. Xie Y, Varshavsky A (2000) Physical association of ubiquitin ligases and the 26S proteasome. Proc Natl Acad Sci U S A 97 : 2497–2502. 10688918
17. Huibregtse JM, Scheffner M, Beaudenon S, Howley PM (1995) A family of proteins structurally and functionally related to the E6-AP ubiquitin-protein ligase. Proc Natl Acad Sci U S A 92 : 5249. 7761480
18. Joazeiro CA, Weissman AM (2000) RING finger proteins: mediators of ubiquitin ligase activity. Cell 102 : 549–552. 11007473
19. Aravind L, Koonin EV (2000) The U box is a modified RING finger—a common domain in ubiquitination. Curr Biol 10: R132–134. 10704423
20. Boname JM, Stevenson PG (2001) MHC class I ubiquitination by a viral PHD/LAP finger protein. Immunity 15 : 627–636. 11672544
21. Mansouri M, Bartee E, Gouveia K, Hovey Nerenberg BT, Barrett J, et al. (2003) The PHD/LAP-domain protein M153R of myxomavirus is a ubiquitin ligase that induces the rapid internalization and lysosomal destruction of CD4. J Virol 77 : 1427–1440. 12502858
22. Petroski MD, Deshaies RJ (2005) Function and regulation of cullin-RING ubiquitin ligases. Nat Rev Mol Cell Biol 6 : 9–20. 15688063
23. Errington WJ, Khan MQ, Bueler SA, Rubinstein JL, Chakrabartty A, et al. (2012) Adaptor protein self-assembly drives the control of a cullin-RING ubiquitin ligase. Structure 20 : 1141–1153. doi: 10.1016/j.str.2012.04.009 22632832
24. Kanlaya R, Pattanakitsakul SN, Sinchaikul S, Chen ST, Thongboonkerd V (2010) The ubiquitin-proteasome pathway is important for dengue virus infection in primary human endothelial cells. J Proteome Res 9 : 4960–4971. doi: 10.1021/pr100219y 20718508
25. Krishnan MN, Ng A, Sukumaran B, Gilfoy FD, Uchil PD, et al. (2008) RNA interference screen for human genes associated with West Nile virus infection. Nature 455 : 242–245. doi: 10.1038/nature07207 18690214
26. Fernandez-Garcia MD, Meertens L, Bonazzi M, Cossart P, Arenzana-Seisdedos F, et al. (2011) Appraising the roles of CBLL1 and the ubiquitin/proteasome system for flavivirus entry and replication. J Virol 85 : 2980–2989. doi: 10.1128/JVI.02483-10 21191016
27. Yu Y, Wang SE, Hayward GS (2005) The KSHV immediate-early transcription factor RTA encodes ubiquitin E3 ligase activity that targets IRF7 for proteosome-mediated degradation. Immunity 22 : 59–70. 15664159
28. Blanchette P, Branton PE (2009) Manipulation of the ubiquitin-proteasome pathway by small DNA tumor viruses. Virology 384 : 317–323. doi: 10.1016/j.virol.2008.10.005 19013629
29. Precious B, Childs K, Fitzpatrick-Swallow V, Goodbourn S, Randall RE (2005) Simian virus 5 V protein acts as an adaptor, linking DDB1 to STAT2, to facilitate the ubiquitination of STAT1. J Virol 79 : 13434–13441. 16227264
30. Ulane CM, Horvath CM (2002) Paramyxoviruses SV5 and HPIV2 assemble STAT protein ubiquitin ligase complexes from cellular components. Virology 304 : 160–166. 12504558
31. Fink J, Gu F, Ling L, Tolfvenstam T, Olfat F, et al. (2007) Host gene expression profiling of dengue virus infection in cell lines and patients. PLoS Negl Trop Dis 1: e86. 18060089
32. Bartholomay LC, Waterhouse RM, Mayhew GF, Campbell CL, Michel K, et al. (2010) Pathogenomics of Culex quinquefasciatus and meta-analysis of infection responses to diverse pathogens. Science 330 : 88–90. doi: 10.1126/science.1193162 20929811
33. Barry M, Fruh K (2006) Viral modulators of cullin RING ubiquitin ligases: culling the host defense. Sci STKE 2006: pe21. 16705129
34. Dostert C, Jouanguy E, Irving P, Troxler L, Galiana-Arnoux D, et al. (2005) The Jak-STAT signaling pathway is required but not sufficient for the antiviral response of drosophila. Nature Immunology 6 : 946–953. 16086017
35. Paradkar PN, Duchemin JB, Voysey R, Walker PJ (2014) Dicer-2-dependent activation of Culex Vago occurs via the TRAF-Rel2 signaling pathway. PLoS Negl Trop Dis 8: e2823. doi: 10.1371/journal.pntd.0002823 24762775
36. Sessions OM, Tan Y, Goh KC, Liu Y, Tan P, et al. (2013) Host cell transcriptome profile during wild-type and attenuated dengue virus infection. PLoS Negl Trop Dis 7: e2107. doi: 10.1371/journal.pntd.0002107 23516652
37. Bourgeois MA, Denslow ND, Seino KS, Barber DS, Long MT (2011) Gene expression analysis in the thalamus and cerebrum of horses experimentally infected with West Nile virus. PLoS One 6: e24371. doi: 10.1371/journal.pone.0024371 21991302
38. Munoz-Erazo L, Natoli R, Provis JM, Madigan MC, King NJ (2012) Microarray analysis of gene expression in West Nile virus-infected human retinal pigment epithelium. Mol Vis 18 : 730–743. 22509103
39. Becerra A, Warke RV, Martin K, Xhaja K, de Bosch N, et al. (2009) Gene expression profiling of dengue infected human primary cells identifies secreted mediators in vivo. J Med Virol 81 : 1403–1411. doi: 10.1002/jmv.21538 19551822
40. Delboy MG, Roller DG, Nicola AV (2008) Cellular proteasome activity facilitates herpes simplex virus entry at a postpenetration step. J Virol 82 : 3381–3390. doi: 10.1128/JVI.02296-07 18234803
41. Satheshkumar PS, Anton LC, Sanz P, Moss B (2009) Inhibition of the ubiquitin-proteasome system prevents vaccinia virus DNA replication and expression of intermediate and late genes. J Virol 83 : 2469–2479. doi: 10.1128/JVI.01986-08 19129442
42. Bandi P, Garcia ML, Booth CJ, Chisari FV, Robek MD (2010) Bortezomib inhibits hepatitis B virus replication in transgenic mice. Antimicrob Agents Chemother 54 : 749–756. doi: 10.1128/AAC.01101-09 19949053
43. Gupta A, Jha S, Engel DA, Ornelles DA, Dutta A (2013) Tip60 degradation by adenovirus relieves transcriptional repression of viral transcriptional activator EIA. Oncogene 32 : 5017–5025. doi: 10.1038/onc.2012.534 23178490
44. Widjaja I, de Vries E, Tscherne DM, Garcia-Sastre A, Rottier PJ, et al. (2010) Inhibition of the ubiquitin-proteasome system affects influenza A virus infection at a postfusion step. J Virol 84 : 9625–9631. doi: 10.1128/JVI.01048-10 20631148
45. Schubert U, Ott DE, Chertova EN, Welker R, Tessmer U, et al. (2000) Proteasome inhibition interferes with gag polyprotein processing, release, and maturation of HIV-1 and HIV-2. Proc Natl Acad Sci U S A 97 : 13057–13062. 11087859
46. Yu GY, Lai MM (2005) The ubiquitin-proteasome system facilitates the transfer of murine coronavirus from endosome to cytoplasm during virus entry. J Virol 79 : 644–648. 15596861
47. Lupfer C, Pastey MK (2010) Decreased replication of human respiratory syncytial virus treated with the proteasome inhibitor MG-132. Virus Res 149 : 36–41. doi: 10.1016/j.virusres.2009.12.010 20080137
48. Lopez T, Silva-Ayala D, Lopez S, Arias CF (2011) Replication of the rotavirus genome requires an active ubiquitin-proteasome system. J Virol 85 : 11964–11971. doi: 10.1128/JVI.05286-11 21900156
49. Collins CA, Brown EJ (2010) Cytosol as battleground: ubiquitin as a weapon for both host and pathogen. Trends Cell Biol 20 : 205–213. doi: 10.1016/j.tcb.2010.01.002 20129784
50. Querido E, Blanchette P, Yan Q, Kamura T, Morrison M, et al. (2001) Degradation of p53 by adenovirus E4orf6 and E1B55K proteins occurs via a novel mechanism involving a Cullin-containing complex. Genes Dev 15 : 3104–3117. 11731475
51. Platanias LC, Fish EN (1999) Signaling pathways activated by interferons. Exp Hematol 27 : 1583–1592. 10560905
52. Horvath CM (2004) Weapons of STAT destruction. Interferon evasion by paramyxovirus V protein. Eur J Biochem 271 : 4621–4628. 15606749
53. Ashour J, Laurent-Rolle M, Shi PY, Garcia-Sastre A (2009) NS5 of dengue virus mediates STAT2 binding and degradation. J Virol 83 : 5408–5418. doi: 10.1128/JVI.02188-08 19279106
54. Laurent-Rolle M, Boer EF, Lubick KJ, Wolfinbarger JB, Carmody AB, et al. (2010) The NS5 protein of the virulent West Nile virus NY99 strain is a potent antagonist of type I interferon-mediated JAK-STAT signaling. J Virol 84 : 3503–3515. doi: 10.1128/JVI.01161-09 20106931
55. Kim D, Pertea G, Trapnell C, Pimentel H, Kelley R, et al. (2013) TopHat2: accurate alignment of transcriptomes in the presence of insertions, deletions and gene fusions. Genome Biol 14: R36. doi: 10.1186/gb-2013-14-4-r36 23618408
56. Megy K, Emrich SJ, Lawson D, Campbell D, Dialynas E, et al. (2012) VectorBase: improvements to a bioinformatics resource for invertebrate vector genomics. Nucleic Acids Res 40: D729–734. doi: 10.1093/nar/gkr1089 22135296
57. Trapnell C, Roberts A, Goff L, Pertea G, Kim D, et al. (2012) Differential gene and transcript expression analysis of RNA-seq experiments with TopHat and Cufflinks. Nat Protoc 7 : 562–578. doi: 10.1038/nprot.2012.016 22383036
58. Hall RA, Tan SE, Selisko B, Slade R, Hobson-Peters J, et al. (2009) Monoclonal antibodies to the West Nile virus NS5 protein map to linear and conformational epitopes in the methyltransferase and polymerase domains. J Gen Virol 90 : 2912–2922. doi: 10.1099/vir.0.013805-0 19710254
59. Fragkoudis R, Chi Y, Siu RW, Barry G, Attarzadeh-Yazdi G, et al. (2008) Semliki Forest virus strongly reduces mosquito host defence signaling. Insect Mol Biol 17 : 647–656. doi: 10.1111/j.1365-2583.2008.00834.x 18811601
60. Muller P, Kuttenkeuler D, Gesellchen V, Zeidler MP, Boutros M (2005) Identification of JAK/STAT signalling components by genome-wide RNA interference. Nature 436 : 871–875. 16094372
61. Anderson SL, Richards SL, Smartt CT (2010) A simple method for determining arbovirus transmission in mosquitoes. J Am Mosq Control Assoc 26 : 108–111. 20402359
Štítky
Hygiena a epidemiologie Infekční lékařství LaboratořČlánek vyšel v časopise
PLOS Pathogens
2015 Číslo 9
- Parazitičtí červi v terapii Crohnovy choroby a dalších zánětlivých autoimunitních onemocnění
- Vakcíny proti klíšťové encefalitidě
- Kdy je nejlepší očkovat
- Možné vedlejší účinky očkování
- Imunogenita vakcín
-
Všechny články tohoto čísla
- Ross River Virus: Many Vectors and Unusual Hosts Make for an Unpredictable Pathogen
- Distinct but Spatially Overlapping Intestinal Niches for Vancomycin-Resistant and Carbapenem-Resistant
- Intracellular Survival of Depends on Uptake and Degradation of Extracellular Matrix Glycosaminoglycans by Macrophages
- Type IX Secretion Substrates Are Cleaved and Modified by a Sortase-Like Mechanism
- Structural and Functional Characterization of Anti-A33 Antibodies Reveal a Potent Cross-Species Orthopoxviruses Neutralizer
- Suppression of a Natural Killer Cell Response by Simian Immunodeficiency Virus Peptides
- Inhibition of Translation Initiation by Protein 169: A Vaccinia Virus Strategy to Suppress Innate and Adaptive Immunity and Alter Virus Virulence
- Enteropathogenic Uses NleA to Inhibit NLRP3 Inflammasome Activation
- Flavodoxin-Like Proteins Protect from Oxidative Stress and Promote Virulence
- Cullin4 Is Pro-Viral during West Nile Virus Infection of Mosquitoes
- The NLRP3 Inflammasome and IL-1β Accelerate Immunologically Mediated Pathology in Experimental Viral Fulminant Hepatitis
- DYRK2 Negatively Regulates Type I Interferon Induction by Promoting TBK1 Degradation via Ser527 Phosphorylation
- A KSHV microRNA Directly Targets G Protein-Coupled Receptor Kinase 2 to Promote the Migration and Invasion of Endothelial Cells by Inducing CXCR2 and Activating AKT Signaling
- The Operon Essential for Biofilm and Rugose Colony Development in
- ADAP2 Is an Interferon Stimulated Gene That Restricts RNA Virus Entry
- The Role of the Antiviral APOBEC3 Gene Family in Protecting Chimpanzees against Lentiviruses from Monkeys
- The Deacetylase Sirtuin 1 Regulates Human Papillomavirus Replication by Modulating Histone Acetylation and Recruitment of DNA Damage Factors NBS1 and Rad51 to Viral Genomes
- Experimental Malaria in Pregnancy Induces Neurocognitive Injury in Uninfected Offspring via a C5a-C5a Receptor Dependent Pathway
- Intrahepatic Transcriptional Signature Associated with Response to Interferon-α Treatment in the Woodchuck Model of Chronic Hepatitis B
- Adipose Tissue Is a Neglected Viral Reservoir and an Inflammatory Site during Chronic HIV and SIV Infection
- Infection Is Associated with Impaired Hepatic Dimethylarginine Dimethylaminohydrolase Activity and Disruption of Nitric Oxide Synthase Inhibitor/Substrate Homeostasis
- Conserved Motifs within Hepatitis C Virus Envelope (E2) RNA and Protein Independently Inhibit T Cell Activation
- The RelA/SpoT Homolog and Stringent Response Regulate Survival in the Tick Vector and Global Gene Expression during Starvation
- Hybridization in Parasites: Consequences for Adaptive Evolution, Pathogenesis, and Public Health in a Changing World
- KSHV Latency Locus Cooperates with Myc to Drive Lymphoma in Mice
- Immunostimulatory Defective Viral Genomes from Respiratory Syncytial Virus Promote a Strong Innate Antiviral Response during Infection in Mice and Humans
- Retraction: Extreme Resistance as a Host Counter-counter Defense against Viral Suppression of RNA Silencing
- Appetite for a Foodborne Infection
- Here I Am, Despite Myself
- Microbial Regulation of p53 Tumor Suppressor
- Fiat Luc: Bioluminescence Imaging Reveals In Vivo Viral Replication Dynamics
- Knocking on Closed Doors: Host Interferons Dynamically Regulate Blood-Brain Barrier Function during Viral Infections of the Central Nervous System
- Rapid Lymphatic Dissemination of Encapsulated Group A Streptococci Lymphatic Vessel Endothelial Receptor-1 Interaction
- Simian Immunodeficiency Virus Infection of Chimpanzees () Shares Features of Both Pathogenic and Non-pathogenic Lentiviral Infections
- Epicellular Apicomplexans: Parasites “On the Way In”
- The Depsipeptide Romidepsin Reverses HIV-1 Latency
- Skin-Derived C-Terminal Filaggrin-2 Fragments Are -Directed Antimicrobials Targeting Bacterial Replication
- Type IV Pili Composed of Sequence Invariable Pilins Are Masked by Multisite Glycosylation
- Heterosexual Transmission of Subtype C HIV-1 Selects Consensus-Like Variants without Increased Replicative Capacity or Interferon-α Resistance
- Prevention of Influenza Virus-Induced Immunopathology by TGF-β Produced during Allergic Asthma
- Global Analysis of Mouse Polyomavirus Infection Reveals Dynamic Regulation of Viral and Host Gene Expression and Promiscuous Viral RNA Editing
- Modulation of the Host Lipid Landscape to Promote RNA Virus Replication: The Picornavirus Encephalomyocarditis Virus Converges on the Pathway Used by Hepatitis C Virus
- Intrinsic MyD88-Akt1-mTOR Signaling Coordinates Disparate Tc17 and Tc1 Responses during Vaccine Immunity against Fungal Pneumonia
- PLOS Pathogens
- Archiv čísel
- Aktuální číslo
- Informace o časopisu
Nejčtenější v tomto čísle
- Epicellular Apicomplexans: Parasites “On the Way In”
- Fiat Luc: Bioluminescence Imaging Reveals In Vivo Viral Replication Dynamics
- Knocking on Closed Doors: Host Interferons Dynamically Regulate Blood-Brain Barrier Function during Viral Infections of the Central Nervous System
- A KSHV microRNA Directly Targets G Protein-Coupled Receptor Kinase 2 to Promote the Migration and Invasion of Endothelial Cells by Inducing CXCR2 and Activating AKT Signaling
Zvyšte si kvalifikaci online z pohodlí domova
Mazová zátka a její řešení
nový kurzVšechny kurzy